- PushRenderspushrenders.com
Elaboramos renderizados fotorrealistas de alta calidad, imágenes, tour 360º e infografías 3D para concursos y PFC, enfocado a arquitectura, urbanismo, paisajismo y diseño de interior.
- PushSpringpushspring.com
PushSpring is the leading independent provider of device level targeting data and insights for verified iOS and Android mobile app audiences. The PushSpring data management platform provides advertisers with complete audience composition and interest data to acquire audiences, drive targeted engagement and increase ad monetization. Using advanced machine learning techniques applied to billions of monthly mobile app and device-level signals, PushSpring data scientists create targeting Personas and custom segments that represent the most accurate, multi-dimensional classification of mobile app audiences available. Distributed across major DMPs, DSPs, and programmatic platforms, Advertisers access PushSpring audience data to drive significant lift for mobile branding and performance objectives.
- Pushwooshpushwoosh.com
Pushwoosh provides the most diverse cross-platform push notifications system that lets marketers, mobile developers, and app owners reach and engage their audience with unprecedented ease.
Pushwoosh has changed the dynamics of mobile marketing with introduction of the free full-featured push notifications service back in 2011. The company supports the idea of working closely with its community to deliver the responsive platform based on the latest tendencies in mobile communication channels.
- Pushy Motherspushymothers.com
Pushy Mothers is the leading outdoor buggy exercise class.
- Puspa Catering Servicespuspacatering.com
Puspa Catering Services is a company based out of Jalan Pancoran Timur, Mampang Prapatan, India.
- PT. PUSPA PHARMApuspapharma.com
Puspa Pharma is a pharmaceutical company based in Jakarta-Indonesia. Puspa Pharma was founded in 2002 and known as PT. Jamu Puspo Internusa.
Puspa Pharma is one of the herbal champions of PUSPA GROUP. Its marketing activities and promotional campaigns have been known as most aggressive and innovative in its industry.
Puspa Pharma made its first debut in the first year the company was established. Its first product, PACEKAP, noni fructus (morinda citrifolia) extract, made a national phenomenal marketing success, being the only herbal product (in its category) to launch extensive television commercials, print and radio advertisement, and aggressive below the line activities. Within months, PACEKAP earned 70% top of mind and its success story was written in major newspapers and business periodicals nationwide.
Driven by the success, Puspa Pharma has also successfully launched its other herbal products, such as PACE TEA, a natural blend of green tea and noni fruit. In 2005, NONI TEA, the export-only rebranding of PACE TEA, is launched in United Arab Emirates, Saudi Arabia, and Malaysia.
Currently, our products have grown into 3 groups, Ethical Prescription Products, Over-The-Counter and Nutraceuticals, and Medical Devices. Some of our featured products are Jointmax, Rebone, Bioquinone, DirectTest, and many more.
Our production facility is located in Sentul-West Java, about 40km from Jakarta. This newly-built facility has just been certified with cGMP license.
- PT Pupuk Sriwidjaja Palembangpusri.co.id
Established from restructuring, PT Pupuk Sriwidjaja Palembang strives become a strong and thriving Company in National and Regional fertilizer industry.
PT Pupuk Sriwidjaja Palembang was formed on November 12, 2010 as a new subsidiary of PT Pupuk Sriwidjaja (now PT Pupuk Indonesia Holding Company). Although it was legally established at the end of 2010, the Company has had a long history through the operations of PT Pupuk Sriwidjaja which was founded on December 24, 1959. At the time, PT Pupuk Sriwidjaja was a Company that aimed to carry out and support the government's policies and programs in economic sector including national development in general, particularly in fertilizer industry and other chemical industries, through production, trade, engineering service, and other businesses.
- Pusser's Caribbean Grillepussersusa.com
- Pusula Publishing Ltd.pusula.com
Pusula Yayıncılık Ltd. 1995 yılından bu yana Türkiye'deki teknoloji, bilgisayar kitapları ve bilişim kültürü yayıncılığında önde gelen kuruluşlardan biridir.
Geleneksel yayıncılığın yanı sıra, teknoloji ve bilişim kültürü alanında online projeler de geliştirmektedir.
--
Founded in 1995, Pusula Publishing is an independent company. Pusula's Who's Afraid of... series comprises the most popular computer books in Turkey, and Pusula Ltd. has realized many projects in the information technology sphere, publishing magazines and encyclopedias in both digital and print media.
- Petroleum University of Technologyput.ac.ir
The Petroleum University of Technology was established in 1939 in Abadan, Iran under the name Abadan Institute of Technology. This university has four faculties: Abadan Faculty of Petroleum Ahwaz Faculty of Petroleum Mahmudabad Faculty of Marine Sciences Tehran Faculty of Petroleum (Petroleum School of Accounting and Financial Sciences) The Petroleum University of Technology was established in 1939 in Abadan, Iran under the name Abadan Institute of Technology.(AIT) PUT is teaching graduate and post-graduate students, and is collaborating with other universities in Iran and abroad to make this possible. PUT has sent some post-graduate students to foreign countries and is co-operating with some of the native universities to start majors for upstream professions in oil industry. Beside the educational activities, PUT enjoys the most advanced research possibilities. Being in close relation with Iranian oil industry as well as research centers in other countries, PUT has optimized the capacities of its students and improved their skills. Maintaining great resources of oil and gas in the country and educating the expert man-power for the development and optimum exploitation of these resources are among the priorities and strategic goals that the Ministry of Oil pursues. To achieve this goal, it is the task of PUT to educate as many B.S., M.S. and Ph.Ds as are required. PUT is an ideal school for training graduate and post-graduate students, and is in collaboration with other universities in Iran and abroad. PUT has sent some post-graduate students to foreign countries and is cooprating with some of domestic universities inside the country to begin majors for upper-hand professions in oil industry. Beside the educational activities, PUT enjoys the most advanced research possibilities. Being in close contact with Iranian oil industry and also research centers in other countries, PUT has optimized the capacities of its students.
- Poznan University of Technologyput.poznan.pl
Początki wyższego szkolnictwa technicznego w Poznaniu sięgają roku 1919, kiedy to Naczelna Rada Ludowa powołała Państwową Wyższą Szkołę Budowy Maszyn. Regularne zajęcia z niewielką początkowo liczbą studentów rozpoczęły się 1 września tego roku. Niestety zanim doszło do pierwszego absolutorium obniżono status szkoły usuwając z jej nazwy przymiotnik „wyższa". Natychmiast też rozpoczęły się starania o przywrócenie tej rangi.
Kampus Wilda. Budynek Rektoratu Politechniki Poznańskiej. Archiwum Biura Rektora, 2005.
W roku 1921 w „Wiadomościach Technicznych" ukazał się „Memoriał w sprawie założenia politechniki w Poznaniu" zawierający uzasadnienie powołania takiej uczelni, propozycje realizacji planu dotyczące potrzebnego gruntu, gmachu, kosztów jego budowy, urządzeń i funkcjonowania uczelni. Starania odniosły sukces i działająca od roku 1919 Państwowa Wyższa Szkoła Budowy Maszyn otrzymała nazwę Państwowej Wyższej Szkoły Budowy Maszyn i Elektrotechniki, a w roku 1930 została poszerzona o Wydział Elektryczny.
W takim kształcie Szkoła działała do wybuchu II wojny światowej, a jej mury opuściło 716. absolwentów.
- Putnam Associatesputassoc.com
Putnam Associates is a premier strategy consulting firm serving biopharmaceutical, diagnostics, medical device clients, and the private equity / venture capital community. For over 25 years, we have offered objective, high impact strategic advice and analytical services, helping to support clients in crucial business decisions at all stages of the product and franchise lifecycle.
- Putcoputco.com
Putco, a leading manufacturer, importer, distributor, and designer of automotive accessories. Located in
Des Moines Iowa, we offer a large assortment of automotive accessories for the SEMA aftermarket and O.E.M. markets. Since 1969, Putco has been a leader in our chosen markets.
- Putevi AD Uziceputeviuzice.com
- Generation Now Mediaputhiyathalaimurai.com
- Puthiyathalaimurai TVputhiyathalaimurai.tv
No.1 News Channel in Tamil Nadu, The most popular tamil news channel in the world, Latest news from tamilnadu india and around the world, Watch live streaming tamil news at Puthiya Thalaimurai, Breaking news in tamilnadu, Watch live tamil news at Puthiya Thalaimurai Live TV with High Definition
- Puthumana Indiaputhumanaindia.com
Puthumana India is a company based out of 5, SASTRI NAGAR, 1ST STREET, Tirupur, Tamil Nadu, India.
- putitoutputitout.co.uk
You care about your customers, without them you are lost.
You know you need to keep up with changing technology to help give you the edge.
Digital experts: We are digital experts, a mobile apps and website production agency with more than 300 digital products delivered for brands such as BBC, McDonalds, Greggs, Thomson, Virgin Media, Durex, NHS, Dulux, Laphroaig, Nissan, Honda, McCain, and Cancer Research UK to name a few.
Tangible reach: We help you understand, define and build relevant digital products to give you a tangible, measurable reach - providing you solid foundations you can amplify.
Our process: Simple and transparent, we take complex ideas and deliver them using language and processes that every stakeholder can understand. We make sure you are part of our team.
Longevity: We're proud of our work and have ongoing clients who are testament to our ability to continuously deliver.
Iterations: Keeping you in line with the world as it looks tomorrow. As pioneers and innovators we're here to advise you and help products improve through iterations; the most important part of the whole process.
Life moves pretty fast. If you don't stop and look around once in a while, you could miss it.
A fast moving world must lead to constant change.
How can we help you? Get in touch 0207 100 2034
- Putki ja Levyrakenne Oyputkijalevyrakenne.fi
Putki ja Levyrakenne Oy
Olemme muuttaneet 1.5.2011!
Uusi osoitteemme on Kartanontie 33, 04740 Sälinkää.
Putki ja Levyrakenne Oy on 1962 perustettu perheyritys.
Toimipaikkamme on Sälinkään kylässä Mäntsälässä,
missä yhtiöllä on toimiston lisäksi myös 1000 m2:n raskaslevyhalli.
Tuotteemme
Yrityksemme suorittaa erilaisia metallialaan kuuluvia palveluja, kuten säiliöiden, putkistojen, sekä erilaisten painelaitteiden valmistus-, asennus- ja muutostöitä.
Valmistamme ja asennamme myös rautarakenteita. Laatutason varmentamiseksi toimintamme perustuu painelaitedirektiivin soveltamisohjeisiin kohteen vaativuuden mukaan.
- Putman Mediaputman.net
Putman is a privately held B2B media firm with 75 years of experience serving manufacturing communities. Clients who have worked with us for awhile often describe us as fast, flexible and friendly, or something along those lines. That is a reflection of the fact that we attract very capable people who are entrepreneurs at heart and love the business and the people in it. And they are empowered to act quickly, but thoughtfully in creating great media products and services.
Our print magazines are some of the finest in their respective fields (we think they are THE finest) in large part because we have an experienced and passionate editorial staff, and because they report to a VP Content, not a publisher. A lot of media companies say 'content is king', but we put our money where our mouth is on this subject.
In digital media we are successfully expanding the community we built with print and are bringing visitors more actionable, unique content and tools for doing their work. With regard to clients, we are leading the dialogue on ROI and successfully integrating print and digital efforts. A few examples include our use of best in class analytics, ad serving and campaign reporting, and launching the first ever client consulting team, aimed at offering VIP clients counsel on 'best practices' in marketing to our audiences.
- Putman Groepputmangroep.com
De Putman Groep is een gespecialiseerd bedrijf op het gebied van:
• Produceren en verkopen van primaire en secundaire bouwgrondstoffen;
• Recyclen en inzamelen van bouw- en sloopafval;
• Sloopwerken;
• Infra-werken.
De producten en diensten worden voortdurend geoptimaliseerd met als uitgangspunt het zorgdragen voor het vereiste kennisniveau en vakmanschap bij gemotiveerde en kwaliteitsbewuste medewerkers die effectief samenwerken, waarbij de klanten centraal staan.
De bedrijfsvoering houdt rekening met de veiligheid, gezondheid en welzijn van de medewerkers en committeert zich aan de geldende maatschappelijke normen, voorschriften en wetten.
Het streven is voortdurend een bevredigend rendement te behalen ten behoeve van de continuïteit en groei van de onderneming.
- Putnam Investmentsputnam.com
Putnam Investments is a global money management firm with 75 years of investment experience.
Our broad range of investment products includes advisor-sold mutual funds; 401(k)s, IRAs, and other retirement plans; variable annuities; and institutional portfolios.
Putnam 529 for America is sponsored by the State of Nevada, acting through the Trustees of the College Savings Plans of Nevada and the Nevada College Savings Trust Fund. Anyone may invest in the plan and use the proceeds to attend school in any state. Before investing, consider whether your state's plan or that of your beneficiary offers state tax and other benefits not available through Putnam 529 for America. If you withdraw money for something other than qualified higher education expenses, you will owe federal income tax and may face a 10% federal tax penalty on earnings. Consult your tax advisor. Putnam Retail Management, principal underwriter and distributor. Putnam Investment Management, investment manager.
For important disclosure, go to www.putnam.com/socialmedia
Putnam Retail Management
- Putnam Bankputnambank.com
Putnam Bank is a community bank, headquartered in Putnam, Connecticut, dedicated to providing superior products and exceptional customer service. Putnam Bank is more than just a bank, it is the people who work day-in and day-out to improve both the Bank and the communities we serve.
Our principal business activities include the origination of mortgage loans secured by one- to four-family residential real estate, loans secured by non-residential real estate and multi-family real estate, residential construction loans, commercial loans as well as consumer loans. We also offer a wide variety of deposit accounts, including checking, savings, and certificates of deposit. Deposits are our primary source of funds for our lending and investing activities.
- Putnam Funeral Homeputnamcares.com
Putnam Funeral Home is an Information Technology and Services company located in 11 E Chicago St, Coldwater, Michigan, United States.
- Putnam Chevroletputnamchevrolet.com
Welcome to Putnam Chevrolet Pontiac, your California Chevrolet and California Pontiac dealer, as well as Jefferson City Chevrolet and Jefferson City Pontiac dealer, serving surrounding cities in Missouri for over 70 years. Here at Putnam Chevrolet Pontiac, we are committed to customer satisfaction. Our website is a great place to find all the information you need to find the right Chevrolet or Pontiac car, truck, or SUV of your dreams in the California and Jefferson City areas of Missouri. In addition, we offer commercial and fleet lines, including dump trucks and medium duty trucks!.
- Putnam Lexusputnamlexus.com
We are a family-owned and operated Lexus dealership and service center, and the only Bay Area Lexus dealer to be in business for 25 years. Located in Redwood City, we pride ourselves on providing each and every one of our great customers with the best customer service known to mankind.
We offer free car washes for all Lexus and Jaguar drivers by appointment each weekday from 8:30-4pm. Please call us one day ahead of time to schedule one.
If you would like to learn more about our dealership or schedule a test drive or service, then please feel free to contact us at 650-363-8500 or via our website at putnamlexus.com.
- Putnam Plasticsputnamplastics.com
Putnam Plastics Corp. provides thermoplastic extrusion and thermoset polyimide tube solutions for catheters and minimally invasive devices. Tube finishing operations include printing, tipping, and laser machining. The company offers custom prototype development through manufacturing of multi-lumen, coextruded, braided, coiled, wire-coated, bumped, tapered, and intermittent extruded tubes, as well as complete catheter assemblies..
- Putnam Ridgeputnamridge.com
NURSING AND REHABILITATION CENTER
ADULT DAY CARE SERVICES
At Putnam Ridge, we offer an enlightened approach to providing health care services to the elderly. Our philosophy is to ensure that residents have skilled and compassionate care while enabling them to experience the highest quality of life. Putnam Ridge's mission is to provide a place where the elderly are treated with dignity and respect, supporting each person's independence and self-esteem.
- Putnam County School Districtputnamschools.org
K-12 School District in NE Florida
- The Putney Financial Groupputneyfinancial.com
For more than a quarter of a century, the principals at Putney Financial Group has been helping individuals, families and institutions realize their financial dreams. Putney provides its clients with access to its knowledge of asset allocation, portfolio modeling and risk management. We skillfully integrate all three phases of capital development: creation, conservation and distribution. This unique process has enabled Putney to build many long-term relationships with clients of diverse assets, goals and interests. Tax planning, trusts, estate, and philanthropic planning are part of our investment management services. Many of our clients are appreciative of history, art and culture which we integrate into our family legacy planning strategies.
- Putney, Twombly, Hall & Hirson LLPputneylaw.com
Founded by William B. Putney in 1866, Putney, Twombly Hall & Hirson LLP is one of the oldest law firms in New York City and one of few that has thrived for well over a century. Our archives chronicle the history of a firm that has earned respect in the legal profession for exceptional representation of its clients by outstanding, highly motivated lawyers who focus on results, personal attention and longstanding client relationships.
- The Putney Schoolputneyschool.org
The Putney School stands for a way of life. Putney is committed to developing each student's full intellectual, artistic and physical potential. Putney students are encouraged to challenge themselves intellectually, to pursue rigorous learning for its own sake, to actively participate in and appreciate the arts, to contribute meaningfully to the work program that sustains the school community and the farm on which it is located, to engage in vigorous athletics, and to develop a social consciousness and world view that will provide the foundation for life-long moral and intellectual growth.
- Putnik ATDputnik.com
PUTNIK is a modern company for leisure, travel and tourism, offering to its customers variety of services for individual guests as well as for the groups of tourists, both in Serbia and all around the world whether it is for business or purely pleasure reasons.Main business are:
- Customer Inclusive Tours
- Incoming Receptive Services
- Special Programs
- Rent a Car - Hertz
- Hotels in our property
- Putranto Allianceputranto-alliance.com
Putranto Alliance is a synergy of professional services companies, carefully curated to provide the most comprehensive suite of tailored solutions to meet your legal and corporate requirements. Our experience and expertise come from understanding and applying relevant laws and regulations, including but not limited to, corporation, finance, accounting and tax. We leverage our strong business network to improve business outcomes and results for you. Navigating Indonesia's myriad of regulations can be confusing, and we are here to listen, guide, advise, clarify and assure – so you can focus on growing your business.
- Gemeente Puttenputten.nl
De gemeente Putten is een groen, gastvrij en ondernemend dorp op de Veluwe. Voor de duizenden recreanten en de ruim 24.000 inwoners is Putten een aantrekkelijke gemeente met voor ieder wat wils. De gemeente is bij uitstek geschikt om op de fiets of te voet te verkennen. De natuur kenmerkt zich door bossen, het agrarische buitengebied, het polderlandschap en het Veluwerandmeer.
De organisatie
Ruim 160 medewerkers zetten zich in om het beleid van het gemeentebestuur uit te voeren en om op een klantgerichte wijze de inwoners van Putten te informeren en te begeleiden bij verzoeken.
- Putting Edge Entertainment Corporationputtingedge.com
Looking for excitement? Craving entertainment? Take a break from reality and enter a new dimension of fun in the Ultimate Indoor Glow-in-the-Dark Mini Golf Experience at Putting Edge. Whether six or sixty, male or female, Putting Edge delivers a high energy, high quality experience that is ideal for birthday parties, an outing with family or friends, groups, corporate functions and more, the possibilities are endless.
Think Putting Edge for your next event! From a simple night out, to fundraisers, we make the event planning and execution process easy and hassle free. Enjoy a fun one of a kind experience when you host a glow-in-the-dark event at Putting Edge! Whether you have a group of 10 or 100, throw an event that is sure to be enjoyed by all!
For further information, visit us online at www.PuttingEdge.com
- Faculty of Medicine Siriraj Hospitalputtinun.com
Faculty of Medicine Siriraj Hospital is a company based out of Thailand.
- Putzmeister America, Inc.putzmeisteramerica.com
Putzmeister America, Inc. is a global leader in concrete and material placing equipment with a worldwide reputation for quality, durability, and innovation, which makes work easier for the concrete placing industry.
The Putzmeister Advantage provides technology, longevity and support across all of our product lines, including: Truck-Mounted Concrete Boom Pumps, Truck-Mounted Telescopic Belt Conveyors, Concrete Transit Mixers, Separate Placing Booms, Trailer-Mounted Concrete Pumps, Truck-Mounted Line Pumps, Mortar, Grout, Shotcrete, Plaster and Fireproofing, Tunneling Machinery, Shotcrete Technology, Pipe Technology and Industrial Technology.
- Putzmeister Underground Technology | Putzmeister Ibérica, S.A.putzmeisterunderground.com
Putzmeister Underground develops concrete spraying equipment for underground mining and tunnel construction, designed to increase productivity and operator safety. The shotcrete spraying range is complemented by concrete transport and utility equipment.
Putzmeister Ibérica markets the entire range of Putzmeister concrete pumping technology in the region.
http://www.putzmeisterunderground.com/
- Puur ITpuur-it.nl
PUUR-it is sinds 2006 de partner in IT netwerk oplossingen: Pure kostenbesparende netwerkoplossingen met beveiliging tussen mensen, applicaties en servers.
Ontwerp, inrichting en beheer van zowel vaste, draadloze als mobiele netwerken met als thema vrijheid in veiligheid.
Uw business in netwerken is mensenwerk met oplossingen van meerdere bedrijven; teamwork.
Puur zorgt dat IT oplossingen een middel zijn en niet een doel zodat uw zaken doorgaan.
Mist u de veilige en zekere schakel tussen werken en ondersteunende IT diensten?
- PUUR Design & Interieurpuurdesign.nu
Niet alleen particulieren voelen zich thuis bij PUUR Design, maar ook zakeijke relaties, architecten, en stylistes zijn bij ons van harte welkom!
Een kantoor of kantine inrichten in de stijl die bij jou en jouw collega's past is het halve werk. In een sfeervolle werkomgeving wordt er nu eenmaal efficienter en prettiger gewerkt.
Ook voor de inrichting van een restaurant, hotel of spa ben je bij ons aan het juiste adres. Dankzij onze enorme collectie meubelen; van stoelen tot bedden, van tafels tot en met servies en glaswerk toe kunnen wij aan alle wensen voldoen.
Iedereen is anders en zo is ook ieder project anders. Wij passen ons aan jouw wensen aan!
Heb je begeleiding tijdens het gehele traject nodig inclusief kleur- meubel- of lichtadvies? Of wellicht zijn bijna alle keuzes al gemaakt en kijken we samen alleen naar de puntjes op de i.
Onze creative medewerkers tekenen indien gewenst de ruimtes en inrichting in 3D uit. Wij ontzorgen en denken mee om samen tot een stijlvol eindresultaat te komen.
Meer info via onze site / webshop: www.puurdesign.nu of stuur een mail naar [email protected]
- Puur* Eventspuurevents.nl
Puur* Events is in 1996 opgericht door Anna-Maria Giannattasio en Edward Mantel: levensgenieters, organisatietalenten en probleemoplossers.
Puur* Events is gespecialiseerd in het organiseren van bedrijfsuitjes, personeelsfeesten, teambuildingactiviteiten, meetings en maatwerk bedrijfsevenementen.
De visie van Puur* Events is BELEVEN, GENIETEN, ONTHOUDEN…
Beleven*
U staat op het punt iets onvergetelijks te proberen. Ontdek hier een belevenis die blijft hangen, een event dat verbaast of een actief verwenuitje dat zorgt voor buldergelach. Wij helpen en inspireren u graag.
Genieten*
Puur genieten van een event omdat het klopt. Het programma in balans, de budgetbewaking strak. En net die extra moeite maakt uw event of uitje tot een daverend succes. Ons team zorgt voor inspiratie en wapperende handjes. U hoeft alleen maar te reserveren en te genieten.
Onthouden*
Moeite, tijd en geld. Een event of uitje kost bakken bloed, zweet en tranen. En dan wil je wel een blijvend effect. Ons motto: beleven-genieten… maar vooral onthouden... Nu en over pakweg 20 jaar. Daarom zijn onze arrangementen en feesten zo goed. Want we gaan niet voor vluchtig...
We gaan voor PUUR!
- Puur Giannipuurgianni.nl
Puur Gianni verzorgt voor particuliere en zakelijke relaties een Sardijns-Italiaanse kok-aan-huis, catering (lunches, borrelhapjes, buffetten), pizza op locatie, Italiaanse barbecue, workshops Italiaanse specialiteiten (pizza bakken, stuzzicini, antipasti, verse pasta, complete menu's).
- Gourmandisepuurgourmandise.nl
- Puur Makelaarspuurmakelaars.nl
Puur Makelaars heeft een team van zeer ervaren gecertificeerde makelaar-taxateurs en professionele binnendienstmedewerkers. Zij zorgen er altijd voor dat onze klanten op de hoogte zijn van hetgeen wij doen en vooral waarom. Ons team zorgt voor een zorgeloze aankoop, of verkoop van een huis. En natuurlijk altijd tegen de beste voorwaarden!
Onze werkwijze
Vanaf het eerste gesprek tot het champagnemoment zijn wij een partner voor je. We luisteren naar jouw wensen en stellen vragen. Soms zijn dat lastige of kritische vragen, maar zo komen we erachter wat voor jou de meest ideale oplossing is. Soms is dat niet de oplossing die op het eerste gezicht het meest voor de hand ligt. Soms is het zelfs een oplossing die niet meteen leuk is, maar die uiteindelijk voor jou beter uitpakt.
Gedurende het hele aan- of verkooptraject adviseren wij je en houden wij alle financiële, juridische en bouwkundige aspecten in de gaten. We regelen, in nauwe samenwerking met jou, wat er geregeld moet worden. We nemen waar nodig zelf het initiatief, maar we houden je volledig op de hoogte. Wij zorgen dat je tijdens het hele aan- of verkooptraject precies weet waar je aan toe bent.
Groot klantenbestand
Puur Makelaars heeft een zeer groot klantenbestand, waardoor we heel snel een match kunnen maken tussen koper en verkoper. Soms nog voordat een huis officieel op de markt komt.
Meerdere vestigingen
Omdat we meerdere vestigingen hebben, is onze slagkracht groot. Onze makelaars wisselen onderling veel informatie uit, waardoor zij allemaal zeer goed op de hoogte zijn van de snel veranderende woningmarkt. Hierdoor ontdekken we vaak als eerste trends waar we direct op inspelen en waar onze klanten ook direct van profiteren.
Enkele sterke punten, volgens onze klanten
- Grote kennis van de lokale markt
- Betrokken en persoonlijke benadering
- Vakkundige medewerkers
- Goede website met mooie presentatie van het aanbod
- Goede presentatie van de huizen
- Komen afspraken na
- Lokaal bestuur Puurspuurs.be
Puurs is zeer centraal gelegen in Vlaanderen, middenin de zogenaamde ‘Vlaamse Economische Ruit', die gevormd wordt door de steden Brussel, Antwerpen, Gent en Leuven.
Puurs is gesitueerd in het hartje van Klein-Brabant, het uiterste zuidwesten van de provincie Antwerpen. De gemeente is vanuit alle windstreken zeer eenvoudig bereikbaar met de wagen of per trein.
Puurs kan sterke troeven voorleggen: de gemeente combineert een aangename woonomgeving met de nabijheid van heel wat voorzieningen, werkgelegenheid en open ruimte. Troeven die de gemeente nog beter kan benutten en verder kan uitbouwen om in de eerste plaats de levenskwaliteit van haar inwoners te verbeteren en het nog aangenamer te maken voor haar bezoekers, handelaars en bedrijven.
Puurs is ambitieus. De gemeente wil alleen maar tevreden mensen die plezier in Puurs wonen, werken en zich ontspannen. 't Beste van 't beste voor iedereen!
Binnen de gemeente Puurs werkt men al sinds jaren aan een geïntegreerd personeelsbeleid. Een duidelijke visie, een gepast organogram met goed uitgeschreven functiebeschrijvingen, doelgroepgerichte werving, professionele selectie, een gedifferentieerd evaluatiesysteem en een instapdiversiteitsplan vormen daarvoor reeds de basis.
- PUUR! standbouwpuurstandbouw.nl
PUUR! standbouw is een jong en dynamisch standbouwbedrijf uit Goor. We werken op diverse beurzen in binnen- en buitenland en hebben alles in huis voor het ontwerpen, bouwen en inrichten van stands. We realiseren maatwerk standbouw en zijn gespecialiseerd in houtbouw. PUUR! is een bedrijf met de typische Twentse mentaliteit. Vakkundigheid, kwaliteit en betrouwbaarheid vormen de basis van ons bedrijf.
- PuurZuidpuurzuid.nl
Bij PuurZuid kan elke inwoner van Amsterdam-Zuid vragen stellen over zorg, welzijn én maatschappelijke dienstverlening. Omdat PuurZuid altijd dicht in de buurt is, kunnen we u snel (verder) helpen.
www.puurzuid.nl
www.facebook.com/PuurZuid
www.twitter.com/PuurZuid
- Puustelli Group Oypuustelli.com
Puustelli Group Oy valmistaa keittiökalusteita Harjavallassa sijaitsevilla tuotantolaitoksillaan – samalla paikkakunnalla ja samalla tontilla, johon emoyhtiö Harjavalta Oy perustettiin yli 95 vuotta sitten.
Puustelli Group Oy kuuluu Harjavalta-konserniin, joka on kotimainen perheyhtiö. Konserniin kuuluu myös Kastelli-talot. Konsernin palveluksessa työskentelee n. 850 henkilöä ja verkostoineen konserni työllistää yhteensä noin 2000 henkilöä. Liikevaihto v. 2016 oli n. 313 miljoonaa euroa.
Puustelli-keittiöt ovat aina olleet tunnettuja korkeasta laadustaan ja puusepäntaidoistaan. Niinpä Puustelli-keittiöt ja Kastelli-talot ovat jo vuosia olleet alansa markkinajohtajia Suomessa.
Puustelli Group Oy on myös vahvasti kansainvälistyvä organisaatio. Tällä hetkellä Puustelli-keittiöitä viedään Ruotsiin, Venäjälle ja Baltian maihin.
---
Puustelli Group Oy manufactures kitchen fittings at its production plant in Harjavalta – in the same community and indeed on the same plot where the mother company, Harjavalta Oy, was founded more than 95 years ago.
Puustelli Group Oy belongs to the Harjavalta Group, a Finnish family enterprise. The Group also includes Kastelli Houses. The Group and its partner network employs some 2,000 persons and had a turnover of EUR 313 million in 2016.
Puustelli kitchens have always been known for their high quality and the finesse of their joinery. Thanks to this, Puustelli kitchens and Kastelli houses have been market leaders in Finland for years.
Puustelli Group Oy is also investing in internationalisation, with Puustelli kitchens being exported to Sweden, Russia and the Baltic states at the moment.
- 普信资产管理有限公司puxinasset.com
普信资产管理有限公司 is a company based out of 朝阳, 北京, China.
- Puyallup School Districtpuyallup.k12.wa.us
The Puyallup School District is the eight largest district in the state of Washington, serving a population of approximately 119,000 residents. The district is located six miles east of Tacoma, 30 miles south of Seattle, and is situated in the heart of the Puyallup Valley. The district has 21 elementary schools, seven junior high schools, three comprehensive senior high schools, and an alternative school, all of which serve more than 22,250 students. The district employs approximately 1,255 certificated, 1,388 classified staff, and 750 substitute personnel.
Our Mission
The Puyallup School District, in partnership with our diverse communities, educates and inspires students to reach their full potential.
- Puyallup Dermatology Clinicpuyallupdermatology.com
Puyallup Dermatology Clinic Dr. Crowe, Newman, and Vaughan Diseases of the Skin, Hair, and Nails Puyallup, Washington. Puyallup Dermatology provides the best in assessment, diagnosis, and therapy for diseases of the skin, hair and nails.
- Puyallup Tribe of Indianspuyalluptribe.com
- Puy du Foupuydufou.com
Le Puy du Fou est devenu un phénomène dans le monde du spectacle. Il a brisé les codes et inventé une nouvelle génération de parc avec un concept artistique unique, cinq fois récompensé dans le monde depuis 2012.
6 000 hommes et femmes le font vivre et grandir avec passion. Quel que soit leur poste, ils n'ont qu'un seul objectif : rechercher l'excellence pour créer l'émotion et faire rêver des millions de visiteurs chaque année.
Dans plus de 100 métiers, chacune de nos équipes, chacun de nos talents est encouragé à repousser ses propres limites, à se dépasser et devenir une référence dans son domaine. Viser plus haut pour rendre possible ce qui paraît impossible, c'est notre ambition car les rêves sont faits pour être réalisés !
Chaque jour, nous réalisons des rêves ! Et vous ?
http://recrutement.puydufou.com/accueil
- Puyi Opticalpuyioptical.com
Puyi Group triumphs as a trendsetter and visionary in the high-end optical retail industry. Founded in 2000 by Mr. Jeffery Yau, Chief Executive Officer, Puyi Group embodies the East-meets-West philosophy. It endeavours to provide connoisseurs an exquisite shopping experience that combines sincere, professional services and a comprehensive range of premium, fashionable optics. As the market leader in luxury optics, with its retail network covers Hong Kong, Macau, Beijing, Shanghai and major cities in the Greater China region, the Group has developed different concept stores to tailor diverse needs of customers, including the prestigious Puyi Optical, the cutting-edge Glasstique, O-O Shop with trendy brands, Point De Vue for gentlemen, Reflections for modern ladies and privileged Vault. Puyi also partnered with Linda Farrow to open their first boutique in oversea and with LOTOS to open their first boutique in the world. In 2016, Puyi collaborated with GENTLE MONSTER, the hottest Korean eyewear brand, to open their first flagship store named "THE PLATFORM" in Hong Kong.
- Puzzle ITCpuzzle.ch
Puzzle ITC is a Java software development and Linux system engineering company based in Berne, Switzerland. .
- Puzzle Centrepuzzlecentre.org.uk
The Puzzle Centre charity promotes and delivers early intervention for very young children (2-5 years) with autism or similar communication difficulties. We have an OFSTED 'Outstanding' specialist nursery and provide training and outreach to families and practitioners throughout the UK. Our vision is that every young child with autism or similar communication needs is offered prompt, appropriate and high quality education, therapy and support.
Puzzle Centre has provided its unique and pioneering service for very young children with autism and related disorders and their families since 2001. Our expert multidisciplinary team of teachers and therapists helps to equip children with skills they need to enhance their life chances.
To date, the Centre has worked with over 260 children age 2 to 5 years. Each child has made positive progress in communication, learning, play skills and behaving appropriately.
Through Puzzle 500 parents and carers have also developed specialist parenting skills, confidence and ability to care for and support their child. Parents better understand the statutory educational system and are stronger advocates for their child's education needs. We have helped over 1,500 early years professionals to increase their confidence in caring for and educating young children with autism, particularly supporting communication needs.
We are one of the pioneers of the SCERTS assessment framework in the UK. SCERTS is a rigorously evaluated, research-based educational approach and multidisciplinary framework, which directly addresses core challenges faced by children with autism and their families. Many schools and organisations from around the UK and internationally have visited Puzzle Centre to understand more about implementing SCERTS, including the National Autistic Society, who have now integrated SCERTS into their schools' 'MyProgress' model. We provide training for practitioners about the use of SCERTS at our centre.
- Puzzlespuzzles-solutions.com
We believe that quality brands deserves respect & honer, for changing people's lives, for adding a value in our community & for pushing the Egyptian market forward, that's why we provide our services to these quality brands to help them maintain their values consistently, increase their exposure & awareness & ease the operations & technical functions for them to focus more on their vision, We just happen to know how.
- Puzzles Toys & Morepuzzlestoysandmore.com
Puzzles Toys & More is a company based out of 8 Hall St 3, Dennis Port, Massachusetts, United States.
- Puzzolana Machinery Fabricatorspuzzzolana.net
The Company Founded in 1964 by an enterprising and enthusiastic individual with vision to be part of infrastructure building, Puzzolana Machinery Fabricators today carries on with the same mission it has had since the very beginning to make specialized equipment. Puzzolana started designing, fabricating and supplying customized equipments to small scale industries and today is recognized as leading designers, manufacturers and suppliers of diversified range of products in India and Abroad.
- Papierfabrik Golzern GmbHpv-golzern.de
Papierfabrik Golzern GmbH is a Paper and Forest Products company located in Zur Papierfabrik 2, Grimma, Saxony, Germany.
- PV Labspv-labs.com
PV Labs exists to capture and create the imagery and metadata to satisfy the next generation of geospatial applications. We are an advanced imaging solutions company specializing in the design and development of turnkey aerial imaging systems based on our core technology platforms. Our expertise is in the development of solutions that require high performance stabilization, optics and data management that leverage our common software and hardware components.
For more information on our Entertainment Division please visit www.pictorvision.com
- pv magazinepv-magazine.com
pv magazine is a monthly trade publication launched for the international photovoltaics industry in the summer of 2008. The current print run, based on qualified circulation, is 35,000. It also features daily news updates on its website, publishes a weekly e-mail newsletter, has a comprehensive online table with all the feed-in tariffs and incentive schemes around the world, and much more.
With its independent, technology-focused reporting, pv magazine concentrates on covering the latest PV news, topical technological trends and worldwide market developments.
Categories covered:
* Markets & trends
* Research & development
* Applications & installations
* Industry & suppliers
* Careers & recruitment
* Products
pv magazine readers comprise:
* Key executives and professionals in all segments of the PV manufacturing supply chain
* Project developers dealing in international business and sourcing activities
- P&Vpv.be
P&V is onderdeel van de P&V Groep, een solide Belgische coöperatieve verzekeringsgroep actief sinds meer dan 100 jaar.
Via zijn verschillende verzekeringsmaatschappijen biedt de P&V Groep particulieren, zelfstandigen, bedrijven en instellingen een uitgebreid gamma van levens- en niet-levensverzekeringen aan. Daarbij worden meerdere merken en distributiekanalen ingezet.
- P&V Verzekeringen werkt met een netwerk van exclusieve agenten;
- VIVIUM, ARCES en Piette & Partners verdelen hun producten via makelaars;
- Actel verkoopt direct via internet en via akkoorden met auto-importeurs.
Wil jij graag werken bij de P&V Groep? Kijk op onze careers pagina!
---
P&V fait partie du Groupe P&V, un groupe coopératif d'assurances belge solide qui est actif depuis plus de 100 ans.
À travers ses différentes compagnies d'assurances, le Groupe P&V offre aux particuliers, indépendants, entreprises et institutions une large gamme d'assurances vie et non-vie.
Pour ce faire, le Groupe utilise plusieurs marques et canaux de distribution.
- P&V Assurances distribue ses produits via un réseau d'agents exclusifs ;
- Les produits de VIVIUM, d'ARCES et de Piette & Partners sont vendus par les courtiers ;
- Actel vend ses produits en direct par Internet et via des accords avec des concessionnaires automobiles.
Envie de travailler au sein du Groupe P&V ? Consultez sans attendre notre page carrière !
- PacketVideopv.com
Founded in 1998, PacketVideo has established itself as the leader in delivering innovative digital media solutions globally. PacketVideo's expertise in all things media means our unique technology has the highest performance and reliability in digital media solutions for mobile and consumer electronic products and services. This expertise and experience enables rich media experiences for consumers across the globe.
PacketVideo is the most advanced and trusted digital media solution provider in the industry.
Partnering with PacketVideo helps companies differentiate their products, seize the growing consumer demand for the connected home, and reduce customer attrition by adding compelling value to products and services. With PacketVideo, Communications Service Providers and Consumer Electronics companies have a digital media partner with extensive global experience and that can deliver on large and complex media solution projects, reliably, securely, and with a vision for helping create the digital world of the future.
- Plougmann Vingtoftpv.eu
With more than 50 years of experience, Plougmann Vingtoft is one of Scandinavia's best regarded consulting firms when it comes to strategic consulting, managing, protecting and commercializing of intellectual property rights. (IPR).
Our company has been placed in the patent prosecution Tier 1 for ten consecutive years and has been ranked as "Highly Recommended" by IAM Patent 1000 for several years.
In 2017, we proudly won the MIP Global Award "IP Firm of Year" for Denmark in the category patent prosecution, which confirms the quality of our work as well as our knowhow and expertise around IP counseling.
Plougmann Vingtoft has just over 80 dedicated employees working out of our headquarters in Copenhagen and four additional offices in Aarhus (the second largest city in Denmark), Oslo, Munich and Madrid. In addition to our presence in Europe, we have a huge global network of cooperation partners allowing us to service our large base of clients directly or indirectly in any part of the world.
Additionally, we offer our clients the services of our highly experienced in-house commercialisation and tech trans team which specializes in value generation from new technologies in combination with IPR. We market these services under a separate brand: "tto" which is well-known and well-reputed in the tech trans offices at a large number of European universities. With more than 160 different clients covering several hundred projects since 2004, our tto experts have clearly documented their skills in assisting clients facing challenges in a transition phase from early stage development to commercialization or exit.
- PVApva-gmbh.net
coming soon ....
- PVApva.net
Since 1992, PVA has supplied the world with innovative fluid dispensing solutions that remain at the forefront of motion and application technology. PVA's customer driven solutions are utilized worldwide in industries ranging from solar, semiconductor packaging, printed circuit board assembly, medical device manufacturing, and consumer electronics. Throughout the changing global manufacturing landscape, PVA remains committed to providing our customers with exceptional products and industry-leading global support that far exceeds expectations.
- Paralyzed Veterans of Americapva.org
For almost 70 years, Paralyzed Veterans of America has been on a mission to change lives and build brighter futures for our seriously injured heroes—to empower these brave men and women with what they need to achieve the things they fought for: freedom and independence.
The organization was founded by a band of service members who came home from World War II with a spinal cord injury.
They returned to a grateful nation, but also to a world with few solutions to the challenges they faced. They made a decision not just to live, but to live with dignity as contributors to society. They created Paralyzed Veterans of America, an organization dedicated to veterans service, medical research and civil rights for people with disabilities.
Today, the work continues to create an America where all veterans and people with disabilities, and their families, have everything they need to live full and productive lives.
Paralyzed Veterans national officers and our 34 chapters represent thousands of veterans in all 50 states, the District of Columbia and Puerto Rico.
- PV Agency spa - Communication by Eventspvagency.it
Corporate & Medical Events.
Study of Communication plans.
Corporate road show: study and planning of location and agenda
Sponsors search
Logistics solution
ADV & Web solutions
Technical planning of big corporate events such as convention and product launch.
Event Management in outsourcing
- Prairie View Animal Hospitalpvahosp.com
Prairie View Animal Hospital located in Dekalb, IL serves the towns of DeKalb, Sycamore, Genoa, Cortland, Maple Park, Rochelle, and all surrounding areas. We are a full service companion animal hospital. Our veterinarians care for cats & dogs. We provide a wide array of services to meet your pet's routine, medical, surgical, dental, and boarding needs.
- Pleasant Valley Hospitalpvalley.org
We are a a not-for-profit healthcare system that provides community-oriented healthcare for Mason and Jackson counties in West Virginia and the counties of Gallia and Meigs in Ohio. This 201-bed facility offers a full spectrum of services and includes a 101-bed acute care facility, a 100-bed nursing & rehabilitation center, three medical equipment sites and a wellness center (open to the public).
General services are provided to the community including OB-GYN, radiology, emergency medicine, inpatient and outpatient surgery, neurology, sleep studies, urology, gastroenterology, ophthalmology, orthopedics, oncology/hematology, dialysis (to be available by the Summer of 2007) otolaryngology, home health, hospice, private duty, and a full-range of rehabilitation services. Radiology services include CT with virtual colonoscopy and 64-Slice CT cardiac, MRI, ultrasound, nuclear medicine and mammography. PVH also operates sixteen medical clinics.
We are extending care well beyond the doors of the hospital, offering alternative care options, emergency treatment of major and minor injuries and illness and preventive care and fitness programs. Pleasant Valley Hospital is truly a resource center for our community's healthcare needs.
- Pvalue Analytics Pvt. Ltd.pvalueanalytics.com
Pvalue is….
A specialist Market research data processing organization located in New Delhi, India.
Our aim is to provide complete data processing and advance analysis solutions to Market Research industry.
Pvalue staffed with experts in data processing domain having loads of Market Research experience.
Our team has prior experience of Market Research MNCs like The Nielsen Company, Millward Brown, IMRB, TNS and leading BPOs/KPos like Evalueserve, Annik Systems and GreenField Online etc.
One of our strength is to manage multi country tracking study with minimum or no guidance from the client
Every staff has a good past record of delivering quality data to the clients on time
- John B Coleman Librarypvamu.edu
Library Final Exams Extended Hours - Spring 2015 Library Hours - Spring 2015 Library Hours Library News and Upcoming Events Library Fall Hours Reserve a Meeting Room Mobile Library Applications Faculty / Staff Publications Texas Standard - The Portal to Texas History Newsletters...
- Philips van Horne sgpvanhorne.nl
- PVA srlpvasrl.it
La PVA , acronimo di Personal Virtual Assistant, nasce da una pluriennale esperienza maturata nel settore delle segreterie personali, logistiche, commerciali ed organizzative.
La PVA offre un supporto commerciale e di assistenza personale a liberi professionisti, piccole imprese e società giovani. L'offerta è creata su misura per il cliente e dedica una particolare attenzione ad ogni tipo di azienda ed alle sue necessità.
La PVA fornisce servizi di segreteria in out-sourcing. L'offerta è composta da canoni di abbonamento mensili e da pacchetti prepagati il cui costo varia in base alla tipologia dei servizi da voi scelti.
Tipologia di servizi:
Servizi di segreteria PERSONALE virtuale
Servizi di segreteria DIREZIONALE virtuale
Servizi di segreteria LOGISTICO/ORGANIZZATIVA
Servizi di segreteria AMMINISTRATIVA virtuale
Servizi di segreteria PROGETTATI SU MISURA all inclusive
- P.V.A. systems s.r.o.pvasystems.cz
- Pleasant View Baptist Churchpvbcga.org
The Pleasant View Baptist Church is committed to bringing men and women who do not have a personal relationship with Jesus Christ into fellowship with Him and into responsible church membership through:
Equipping Believers
**
Enriching Persons
**
Evangelizing People
**
Edifying Mission
- Pleasant Valley School Districtpvbears.org
Home Page
- PVBS (Microsoft GovCon Accounting Solutions)pvbs.net
PVBS (Pleasant Valley Business Solutions) offers the premier Microsoft DCAA-compliant ERP, financial management and project accounting solution to high-growth government contractors and product resellers around the world. The solution helps high-growth government contractors and product resellers better manage and optimize their business.
- DBS Cardspvc-cards.biz
DBS Cards is your competent partners from A to Z in all question regarding cards and card systems. We are not only selling cards, but we are also your sparring Partners for ideas and planning of cards applications. Our direct co-operation with the leading manufacture of cards, software and card printers, is the key to provide you the correct offer regarding your needs and requirements in cards. Most importantly, we can support you with attractive pricing too !
Partnering renowned manufactures, we do not only know the printers, but also their applications with regards to customer retention , security or labeling. From planning to realization, from consulting to training and permanent support via hotline DBS is your partners always !
- PETROLEUM EQUIPMENT ASSEMBLY AND METAL STRUCTURE JOINT STOCK COMPANYpvc-ms.vn
PETROLEUM EQUIPMENT ASSEMBLY AND METAL STRUCTURE JOINT STOCK COMPANY is a mechanical or industrial engineering company based out of No 2, Nguyen Huu Canh Street,Thong Nhat, Ba Ria Vung Tau, Ba Ria-Vung Tau, Vietnam.
- Piedmont Virginia Community College - Companypvcc.edu
Piedmont Virginia Community College (PVCC) is a comprehensive, public institution of higher education that awards associate degrees and certificates. As part of the Virginia Community College System, PVCC serves the City of Charlottesville and the counties of Albemarle, Buckingham, Fluvanna, Greene, Louisa and Nelson.
PVCC employs 75 full-time faculty members, 19 administrative and non-teaching faculty and 78 classified staff. More than 250 talented adjunct faculty teach courses each semester.
- Plenty Valley Christian Collegepvcc.vic.edu.au
Located in a magnificent semi rural setting, Plenty Valley Christian College is an independent, co-educational, Prep-12 College. We are a member of Christian Education National (CEN) and as such are committed to the establishment of a close partnership with parents in the Christian education of their children. PVCC students learn within a Christian framework and we endeavour to develop a strong sense of community amongst the students, parents and staff. Every staff member plays a role in the pastoral care of the students.
PVCC offers an extensive program. Our 16 hectare property includes a number of sporting fields and specialist classrooms as well as exceptional playground areas for our younger students.We encourage students to strive to reach their best in academic, sporting and creative endeavours whilst developing an understanding of their place in God's world.
Please do not hesitate to contact us. We encourage prospective parents and students to visit us. We would be delighted to show you around and talk with you.
- Pleasant Valley Construction Co. / PVC Facility Management, Inc.pvccinc.com
Pleasant Valley Construction Company (PVCC) is a family owned corporation doing business as an experienced real estate developer, electrical, and general contractor dedicated to quality construction and efficient management of resources. Our ability to deliver high quality, cost effective projects on schedule is accomplished by employing and supporting motivated, flexible and focused teams. Our past record of major projects including new construction, industrial park, energy lighting retrofits, remodels, rebranding, renovation and reinstallation has earned us a reputation of being creative, mechanically advanced, and extremely responsive to our customers needs. We are committed to providing a well supervised, turn-key facility and/or construction project with the utmost attention paid to customer communication. We bring cutting edge real estate development and construction knowledge at the best price available.
The Construction, Real Estate, and Facilities Management teams are committed to consistently understanding and exceeding our customers' needs and expectations. We accomplish this through effective project management, superior communication and the highest quality workmanship from start to finish. Additionally, we are constantly striving to find new and innovative solutions that provide unparalleled services designed to strengthen our valued partnerships with our customers, our vendors and our employees.
- Pleasant Valley Evangelical Churchpvchurch.net
- Ponte Vedra Club Realtypvclubrealty.com
Serving Ponte Vedra and the greater Jacksonville Beaches since 1937, Ponte Vedra Club Realty is Northeast Florida's most prestigious real estate firm. We specialize in premium oceanfront homes and condominiums, beautiful residential homes, townhouses, lots and vacant land and Intracoastal property. Our seasoned real estate agents combine nearly 1,000 years of licensed experience to enhance your search.
Contact our office at 904.285.6927 or visit us directly across the street from both the Atlantic Ocean and our parent company, the 5-Diamond Ponte Vedra Inn & Club. Our second hotel affiliate, the 4-Diamond Lodge & Club is located just an easy 10 minute stroll up the beach.
If you're interested in vacation or long-term rentals, please contact our sister company, Stockton Real Estate, which features over 400 rental properties throughout Ponte Vedra and the Jacksonville Beaches.
Ponte Vedra Club Realty: 904.285.6927.
- Paradise Preparatory Schoolpvcp.org
Paradise Valley Christian Preparatory (PVCP) is a private Christian school in Phoenix, Arizona providing academic excellence.
- Putnam Valley Central School Districtpvcsd.org
Located just an hour north of New York City, in Putnam County, Putnam Valley is a small community that is nestled in gently rolling hills near the Hudson River. Putnam Valley offers its 11,000 residents hundreds of acres of unspoiled wilderness and beauty, with an added cosmopolitan influence.
A supportive community with extensive parental involvement, and an active PTA/PTSA, the school district supports academic excellence and a well rounded extra-curricular program. The district's three schools serve 2000 students, and its 300 teachers and staff members are known for their dedication, expertise and commitment to the students.
Putnam Valley boasts a brand new state-of-the-art high school, wireless internet access in all classrooms and buildings, and a one to one laptop program for all students. Our award winning technology program is leading the way through the 21st century, giving our students cutting edge training in new areas of study for the future.
- PVD Engineeringpvd-engineering.be
The focus of PVD Engineering is set on the plastic injection moulding industry.
Within this area we can offer you consultancy solutions; 3D-2D design of product and moulds for plastic injection; material selection; support the manufacturing of your tools; debug new and existing processes; support you on automation; …etc. We can offer you the necessary support in project management which is based on the ISO TS 16949 philosophy. Feel free to contact me for a company presentation.
Beside this market segment PVD Engineering is also active in the metal construction industry. The focus is set to the 3D & 2D design of special trailers and containers.
PVD Engineering is making use of Siemens PLM Nx6.
- PvdApvda.nl
De PvdA is een vereniging van 50.000 leden die samen bepalen wat er moet gebeuren. Die leden zijn actief in 380 plaatselijke afdelingen en twaalf gewesten. Afgevaardigden uit die plaatselijke afdelingen vormen samen het Congres, het hoogste orgaan van de PvdA.
Voorzitter van de PvdA is Hans Spekman, politiek leider is Lodewijk Asscher. De PvdA is in Europees verband lid van de PES (Partij van Europese Socialisten) en mondiaal van de SI (Socialistische Internationale).
- PvdA Drenthepvdadrenthe.nl
Zowel het bestuurlijk als het politieke deel van de Partij van de Arbeid in Drenthe, inclusief de leden van gedeputeerde en provinciale staten.
- Rhode Island Airport Corporationpvdairport.com
The Rhode Island Airport Corporation (RIAC) is a governmental agency and public instrumentality of the state of Rhode Island which manages all publicly owned airports within the state.
The corporation was formed in 1992 as a semiautonomous subsidiary of the Rhode Island Port Authority, which has since become the Rhode Island Economic Development Corporation. RIAC is responsible for the design, construction, operation, and maintenance of the six state-owned airports, and for the supervision of all civil airports, landing areas, navigational facilities, air schools, and flying clubs throughout the state. The six state-owned airports include T. F. Green Airport, the state's commercial airport with scheduled air carrier service, and the general aviation airports at Block Island, Newport, North Central, Quonset, and Westerly. RIAC is governed by a seven-member board of directors.
- Poelmann van den Broek advocatenpvdb.nl
U weet het: voor deftige juristen met dure praatjes bent u bij Poelmann van den Broek aan het verkeerde adres. Wij zijn advocaten die liever de handen uit de mouwen steken. Op de momenten dat u ons nodig heeft, zijn we er voor u. Met onverslaanbaar samenspel gaan we voor het resultaat waarmee ú verder kunt. En als het moet, strijden we op het scherp van de snede voor uw belangen. Daar ligt onze kracht.
Wij hebben een brede expertise in huis, die we heel gericht kunnen mobiliseren dankzij onze diepgaande kennis van branches. Daarbij zoeken we graag de grenzen op, zeker wanneer een klant daar beter van wordt.
Loopt u tegen een juridisch vraagstuk aan, of wilt u gewoon meer weten over juridische actualiteiten en ontwikkelingen? Neem dan contact op met een van onze advocaten, of meldt u aan voor onze digitale nieuwsbrief op www.pvdb.nl.
- PVDI Designpvdi.com.br
A PVDI é um escritório de design pioneiro no Brasil, fundado em 1960 no Rio de Janeiro por Aloísio Magalhães e hoje dirigido por Claudia Cohen e Joana de Paula Soares com consultoria de Rafael Rodrigues e Nair de Paula Soares. Temos uma atuação abrangente em todos os segmentos de design com uma carteira com mais de 700 marcas criadas e 2.000 projetos desenvolvidos. Nosso percurso de 50 anos é sempre direcionado para uma atualização constante e prospectiva.
- pvd ketamine & wellnesspvdketamineandwellness.com
PVD Ketamine & Wellness is a medical clinic that specializes in providing sublingual ketamine treatments for mental health conditions. They offer supervised ketamine therapy as an alternative treatment for patients suffering from depression, anxiety, PTSD, OCD, bipolar disorder, and substance use disorders who haven't found adequate relief through traditional treatments. The clinic emphasizes the safety, effectiveness, and rapid onset of ketamine therapy, which has shown up to 70% response rates. They offer free preliminary screening consultations with Nurse Practitioners to determine treatment eligibility.
- PV Drillingpvdrilling.com.vn
The Pioneer of Drilling Industry in Vietnam - Belongs to PetroVietnam Corporation.
PV Drilling is a professional provider of drilling rigs and drilling-related services as well as manpower supply for onshore and offshore drilling operation. Over the last decade, PV Drilling has developed significantly and become one of the leading subsidiaries of Vietnam's Oil & Gas Group and a prestigious drilling contractor in the local and regional market. PV Drilling is going to expand its operation to further deepwater areas and overseas market to contribute more to exploration and production of oil and gas resources for Vietnam and the world.
The primary ingredient that made up the success of PV Drilling is the dedicated and outstanding human resources who incessantly pursue knowledge and perfection in mastering the technology, developing the services and creating added values for clients. Therefore, PV Drilling always concentrates on building and developing a human resource with great competence and consider it as top priority in the corporate strategy of development. To serve such purpose, PV Drilling applies a suitable recruitment policy, a systematic career development plan as well as a competitive compensation and benefits scheme for attracting and maintaining talents. At PV Drilling, we consider human factor as the ultimate component for sustainability and breakthrough and this is a one of core values of PV Drilling.
- PETROVIETNAM INVESTMENT CONSULTANCY AND ENGINEERING JOINT STOCK COMPANYpve.vn
- PetroVietnam Exploration Production Corporationpvep.com.vn
Owned by PetroVietnam Group
Core business: Oil and gas Exploration and Production
Activities:
Asia:
- Vietnam
- Malaysia, Myanmar, Indonesia, Laos, Mongolia
- Cuba, Peru, Venezuela
- Tunisia, Algeria, Cameroon, Madagasca, Congo
- Iran, Iraq
- PVF Mesh & Screen Technologypvfgmbh.de
Die PVF Mesh & Screen Technology GmbH ist sowohl Anbieter von Siebdruck- und Industriegeweben als auch Hersteller von MICRON®-Präzisionssieben für den technischen Druck. Dabei liefern wir, was wenige bieten: eine perfekte Produktpallette für höchst anspruchsvolle Anwendungen. Unser Produktportfolio umfasst: Hochmodule Siebdruckgewebe von Polyester über Hybrid bis Edelstahl, MICRON®-Präzisionssiebe für den technischen Druck, APOLAN-Rakelgummi- gegossene Rakeln, Industrie-Gewebe für Filtration, Separation, Luft & Raumfahrt, Medizintechnik, Chemieindustrie, Lebensmittelindustrie + weltweiter Vertrieb. Konfektionierte Gewebe – kundenindividuell gestaltbar.
PVF-Vertriebs GmbH is not only an independent distributor of precision fabrics, but also the manufacturer of MICRON® precision screens for the premium sector.
We offer what few others can: an ideal product line for the most demanding applications. Our product portfolio includes: screen-printing meshes from high modulus polyester and engineered plastic to super stainless steel wire, MICRON® precision screens for technical printing, APOLAN-Squeegee-Systems – moulded Squeegees, Industrial meshes for filtration, separation, air/aerospace, medical, & architectural applications and specialty meshes tailored for custom applications
- Studio PVpvgroup.com
Dubbing, Voiceover, Audio-video postproduction, subtitles & translation for TV and Cinema since 1979.
//////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////////
Doppiaggio, Voiceover, Postproduzione audio-video, sottotitoli e traduzioni per TV e Cinema dal 1979.
- PVH Corp.pvh.com
With a history going back over 135 years, PVH has excelled at growing brands and businesses with rich American heritages, becoming one of the largest global apparel companies.
We are over 35,000 associates operating in over 40 countries and $8.2 billion in 2016 annual revenues. We own and market the iconic CALVIN KLEIN, TOMMY HILFIGER, Van Heusen, IZOD, Arrow, Speedo*, Warner's, and Olga brands and, in addition, market a variety of goods under our own and licensed brands.
We…
· Began in 1881 by mending shirts for miners in Pottsville, PA
· Revolutionized dress shirts with the Van Heusen soft-folding collar in 1921
· Went public on the NYSE in 1920
· Changed our name from Phillips-Van Heusen to PVH Corp. in 2011
· Acquired CALVIN KLEIN in 2003 and grew their revenue from $172 million in 2002 to $2.9 billion in 2014
· Acquired TOMMY HILFIGER in 2010 and grew their revenue from $2.2 billion to $3.6 billion in 2014
· Purchased Warnaco Group in 2013 for approximately $3 billion
· Stay true to our Core Values of passion, integrity, individuality, partnership and accountability
· Support the needs of women and children through The PVH Foundation.
· Established Save the Children® as our worldwide philanthropic partner in 2014
We Are PVH.
*The Speedo brand is licensed for North America and the Caribbean in perpetuity from Speedo International, Ltd.
- peckvonhartelpvh.com.au
peckvonhartel is an award winning practice specialising in the delivery of architecture, interior design, planning, and project facilitation services.
Established in 1980, the practice has been delivering projects throughout Australia and South East Asia for over 34 years.
- PVH - PVHardwarepvhardware.com
PVHardware (PVH) is a provider of innovative solar tracking solutions for the global utility-scale solar market. PVH's product lines are designed and engineered by leading industry professionals to deliver the lowest total cost of installation while providing unparalleled customer service and support during all phases of the project.
In recent years, single-axis trackers have rapidly become the obvious choice for utility-scale PV projects worldwide. The design of PVH's single-axis trackers has been forged over the years in the global utility-scale PV market, incorporating over 6 years of lessons learned, earned from the perspectives of multiple stakeholders of such projects. The result is an investment-grade solar tracker that addresses the multiple needs of the Owner and EPC alike, driving down LCOE of solar PV energy.
- Powell Valley Care Ctrpvhc.org
Powell Valley Care Ctr is a Hospital and Health Care company located in 999 Avenue G, Powell, Wyoming, United States.
- Patiëntenvereniging HOOFD-HALSpvhh.nl
Patiëntenvereniging HOOFD-HALS is een vereniging voor mensen geraakt door hoofd-halstumoren. Deze vereniging is op 1 mei 2016 ontstaan uit een fusie van de NSvG voor stembandlozen en Stichting Klankbord. De vereniging heeft als doel het bevorderen van een zo gunstig mogelijke lichamelijke, psychische en sociale conditie van mensen die te maken krijgen met kanker in het hoofd-halsgebied.
- Pomona Valley Hospital Medical Centerpvhmc.org
Founded in 1903, Pomona Valley Hospital Medical Center (PVHMC) is a nationally recognized, not-for-profit facility, the Hospital's services include Centers of Excellence in oncology, cardiac and vascular care, women's and children's services, and kidney stones. Specialized services including centers for breast health, sleep disorders, a Neonatal ICU, a Perinatal Center, physical therapy/sports medicine, a full-service Emergency Department, robotic surgery, and the Family Medicine Residency Program affiliated with UCLA. Satellite Centers in Chino Hills, Claremont and Pomona provide a wide range of outpatient services including physical therapy, urgent care, radiology and occupational health. Serving eastern Los Angeles County and western San Bernardino County. The hospital is accredited by the Joint Commission on Accreditation of Healthcare Organizations and is currently staffed by over 800 physicians, 2400 employees, and 1,000 volunteers. PVHMC recently earned from The Joint Commission The Gold Seal of Approval™ for a certification as a Primary Stroke Center for Los Angeles County. PVHMC was also recently named one of the Top 50 Cardiovascular Hospitals in the nation by Thomson Reuters. www.pvhmc.org.
- People Vision H.R.pvhr.com
People Vision is an HR and Training Consultancy specialising in human resources strategy, management and development.
We work with organisations, both large and small, that need extra HR support either on-going or by project basis. Some organisations use People Vision as their virtual human resource HR department. That includes coaching, training and development as well as HR strategy. Our clients work in public, private and not for profit sectors throughout the UK.
- Prairie View, Inc.pvi.org
Prairie View is a regional behavioral,addiction and mental health system offering a continuum of services for children, adolescents, adults and older adults. As the state's longest-serving, non-profit behavioral health care center - and the only faith-based community mental health center - our professional staff takes pride in bringing about restoration through services that combine compassion with dignity and respect.
Prairie View has five outpatient locations in Newton, east and west Wichita, Hillsboro and McPherson, and a network of behavioral health providers throughout Kansas and the Midwest. Prairie View is the community mental health center for Harvey, Marion and McPherson counties.
- Parkview Group (Australia) Pty Ltdpview.com.au
Parkview is an Australian integrated construction and development company founded on principles of integrity, excellence and innovation.
Since inception in 1997, our service has allowed us to develop strong relationships with a diverse range of clients and to build a portfolio reflecting our ability and experience across multiple sectors and scales within the building arena. Together with our clients, our past accomplishments have included the successful delivery of residential, commercial, hospitality, aged care, industrial and education projects.
Parkview provide a customised service and a holistic approach and draw on the experience of specific individuals best suited to a given project. Our established management team provides an extensive multi-disciplinary background and experience in construction, property development and investment. Parkview has a clear understanding of the delivery process across the various property sectors and the level of quality desired by our clients and partners.
Parkview Constructions forms part of the Parkview Group.
- PVKpvk.org.ua
PVK is a company based out of Ukraine.
- Purohit Vaid Professional Corporationpvlaw.ca
We are a busy and growing law firm with the following specialties:
Real Estate - Residential & Commercial Closings, Private Mortgages & Mortgage Enforcement, Foreclosure & Power of Sale, Residential & Commercial Leases, Draft & Review Agreements, Condominium Law
Litigation - Civil and Corporate/Commercial Litigation, Mortgage & Loan Enforcement, Tribunals
Criminal - Trials and Appeals
Business - Incorporations and related documents, Agreements, Contract drafting
- PVL Communicationpvlcommunication.be
- Création, coordination et rédaction de tout support écrit : journalisme, newsletters, magazines d'entreprise, rapports d'activité, dossiers de presse, publireportages et contenus Internet ;
- conception et organisation d'événements : animation de réunions, conférences, séminaires, salons, workshops, journées portes ouvertes, soirées d'entreprise ;
- élaboration et réalisation de campagnes de communication et d'actions d'information combinant tout type de médias : communication interne, développements stratégiques, campagnes médias, relations presse, outils promotionnels, programmes, mailings.
- PVM Oil Associatespvm.co.uk
PVM, part of TP ICAP group, is the world's leading independent broker of oil instruments. The company was founded in 1971 and has the longest history of any group in the industry as an international crude oil and products broker. Daily turnover averages well in excess of 100 million barrels of Over the counter (OTC) oil derivatives including options and oil futures contracts. The group employs around 140 people globally, including 70 OTC brokers and 14 futures brokers and runs 30 oil desks.
- Presbyterian Villages of Michiganpvm.org
Since 1945, Presbyterian Villages of Michigan has been a premier senior living provider. As a nonprofit, faith-based organization, we're committed to serving senior citizens of all faiths, walks of life and all financial means. Today, our 26 senior living communities span hundreds of miles – from the beautiful shores of Harbor Springs to Detroit's elegant skyline – and fulfill the full spectrum of residential options and health care services for Michigan senior citizens and their families.
Find a full list of our locations at www.pvm.org/locations.
- Platte Valley Medical Centerpvmc.org
Platte Valley Medical Center (PVMC) became the first private general medical-surgical hospital in Adams and Southern Weld Counties in 1960. For 47 years, Platte Valley Medical Center was located on seven acres at 18th and Bridge Street in Brighton. In 2007, Platte Valley Medical Center moved to a 50-acre campus at I-76 and 144th Avenue.
Today, PVMC is a 98-bed community hospital. As a member of the SCL Health System, PVMC has been designated one of the world's most patient-centered hospitals by Planetree, Inc. Platte Valley's 10 Pillars of Healing are incorporated into every patient experience. They include integrative therapies, human interactions, support networks, healing design, education and information, healthy and delicious meals, healing art therapy, spirituality, healing touch, and healthy communities to help patients recover.
Also a nationally ranked top performing hospital, PVMC offers high-level services —including a Primary Stroke Center, an Accredited Chest Pain Center and advanced cardiovascular program, a Level II Special Care Nursery, and innovative surgical, orthopedic and women's services — found in many larger metropolitan hospitals.
- PVM Camp & Conference Centerspvmcamp.com
Since 1981, PVM has led thousands of children and adults to Christ. It continues that legacy today, delivering on its mission to create exceptional experiences that nurture families by hosting retreats, outdoor activities and kid's summer camp at its awesome, 80-acre campus in scenic Preble County, Ohio.
- PetroVietnam Grouppvn.vn
Petrovietnam's business
- Core business:
+ Exploration, Production, Refinery, Petrochemicals, Storage, Transportation and Service in Petroleum Field;
+ Importing and Exporting petroleum materials, equipment and productions;
+ Distributing oil and gas products and hydrocarbon materials;
- Other fields:
+ Surveying, designing, constructing both petroleum and civil sites;
+ Consulting in construction and investment, designing the petroleum and civil projects, manufacturing and trading construction materials;
+ Investing in real estate;
+ Investing in power projects;
+ Operating in Finance, banking, insurance, securities fields;
+ Manpower training and supplying in petroleum fields and labour export;
+ Operating in Hotel, Travel, Office business;
- Peterborough Victoria Northumberland and Clarington Catholic District School Boardpvnccdsb.on.ca
We are an educational organization offering programs at 37 schools for over 15,000 students from Kindergarten to Grade 12 in the city and county of Peterborough, City of Kawartha Lakes, Northumberland County and the Municipality of Clarington. We offer diverse programs and services within a faith-based school system.
- Stichting PVPpvp.nl
De Stichting PVP zorgt voor professionele ondersteuning van cliënten bij de handhaving van hun rechten.
De kerntaken van de stichting zijn:
• individuele cliënten ondersteunen bij het handhaven van hun rechten
• voorlichting geven over cliëntenrechten
• situaties die afbreuk doen aan de rechten van cliënten signaleren en melden
• kennis over patiëntenrechten, eigen registratiegegevens en de beleving van cliënten van hun rechtspositie verzamelen, samenbrengen en verspreiden.
Visie
In haar werk combineert de Stichting PVP ervaring met het cliëntenperspectief met kennis over patiëntenrechten. Ze speelt actief in op ontwikkelingen in het psychiatrisch patiëntenrecht en in de zorg. Waar mogelijk werkt de Stichting PVP samen met andere organisaties. De patiëntenvertrouwenspersoon streeft ernaar om klachten op een zo laag mogelijk niveau op te lossen.
- Pioneer Valley Planning Commissionpvpc.org
The Pioneer Valley Planning Commission is the regional planning agency for the 43 cities and towns that compose the Pioneer Valley Region in mid-western Massachusetts' Connecticut River Valley. PVPC performs myriad services—from bikeway development and traffic counting to writing grant proposals and master plans—in a wide range of planning areas: transportation and transit, environment and land use, community development and historic preservation, economic development, data research and analysis, and Geographic Information System mapping and graphics. PVPC promotes regional collaboration among its member communities and is the primary agency responsible for increasing communication, cooperation, and coordination among all levels of government as well as private business and civic sectors in order to benefit the entire Pioneer Valley region and to improve its residents' quality of life.
- PVR Limitedpvrcinemas.com
Most Admired Multiplex Chain in India, PVR Ltd. was incorporated in April 1995 pursuant to a JV between Priya Exhibitors Private Limited and Village Roadshow Limited, one of the largest exhibition companies in the world. PVR pioneered the multiplex revolution in India by establishing the first multiplex cinema in 1997 at Saket, New Delhi. Today, we own 445 screens spread across 101 cinemas covering 43 cities in India. PVR continues to provide superior quality ambiance, technologically updated systems, and best service standards to ensure customer delight and unmatched cinema viewing experiences.
The company is head quartered in Gurgaon.
- Pedagogisk VikarSentral ASpvs.no
PVS er en brukervennlig vikartjeneste. Vi bemanner alle fagområder i skole og barnehage. Har du utdannelse eller erfaring fra arbeid med barn, og ønsker jobb i skole eller barnehage er PVS rette plassen for deg! Vårt konsept er bygd på kvalitet, kontinuitet, engasjement og tilgjengelighet.
PVS har som mål å være nisjens beste aktør. Vi gjør det vi kan for å være imøtekommende, entusiastiske og tilstede med tid og kompetanse for at både våre kunder og vikarer skal føle seg hørt og ivaretatt. Samtidig er det meget viktig for oss og alltid huske på hvem som er viktigst å ta vare på i en hektisk hverdag, nemlig barna!
- Palm Valley Schoolpvs.org
The Palm Valley School is an independent, K-12, College Preparatory school located in the beautiful Coachella Valley of California. The Palm Valley School is an exceptional learning community that educates, nurtures and challenges each student to achieve excellence and contribute to our global society.
- PVS Chemicalspvschemicals.com
PVS Chemicals is a global manufacturer, distributor and marketer of chemicals and transportation services. We provide dynamic, realistic solutions to industries as diverse and demanding as electronics, manufacturing, steel, agricultural, pharmaceutical, metal finishing, water treatment and food processing.
- Paradise Valley Unified School Districtpvschools.net
Every student has a different dream for their future—their potential as wide open as their possibilities. With every dream, there's a path waiting to be taken, discoveries to be made and abilities to be realized. And that's where we come in: to inspire, to guide, to challenge and to nurture.
- Prairie Valley School Divisionpvsd.ca
Prairie Valley School Division provides great educational opportunities to its more than 8,100
students attending 38 Saskatchewan public schools in 32 communities from Regina Beach and Bethune to the west, to Kelliher and Lipton to the north, Milestone, Sedley and Montmartre to the south and Whitewood and Kennedy-Langbank to the east. The student population includes approximately 1,400 students from First Nations in close proximity to PVSD schools
- PetroVietnam Marine Shipyard J/S Copvshipyard.com.vn
PetroVietnam Marine Shipyard J/S Co is a Shipbuilding company located in Vung Tau, Ba Ria - Vung Tau, Viet Nam.
- PVS CONTRACTORS INC.pvslocates.com
PVS CONTRACTORS INC. is a Construction company located in P.O. Box 21119 ST, St. Catharines, Ontario, Canada.
- PVS Process Equipment, Incpvspe.com
PVS Process Equipment was founded in 1988 and began as a manufactures representative for Upstate New York and Northern Pennsylvania. Eventually PVS Process Equipment started to create its own pneumatic concepts and systems. Now we specialize in pneumatic conveying and industrial air filtration systems. We pride ourselves in the ability to create custom systems that best fit a customer's needs. These systems can be created to transport, discharge, fill, weigh, blend, deliver and/or feed a wide variety of powder and bulk solid materials.. We can retrofit our systems to fit around existing equipment or start from new with a custom pneumatic concept to solve your conveying needs.
- PV Squared Solar (Pioneer Valley PhotoVoltaics Cooperative)pvsquared.coop
Since our founding in 2002, PV Squared has provided renewable energy solutions to homes and businesses throughout the Pioneer Valley and surrounding regions.
We've grown from a four person company to more than ten times that size today. As a worker-owned cooperative, we're invested in the happiness of our clients, the livelihoods of our workers, and the health of our community. We're proud to be creating sustainable, living-wage jobs and strengthening our local economy while supporting the adoption of renewable energy.
We work hard to deliver projects that exceed expectations, not just in terms of power production and financial performance, but also in terms of thoughtfulness and attention to detail. Our client-focused approach has built a reputation for quality and service that is second to none.
We have built PV systems for more than a thousand clients, each with unique project sites and energy goals, and we utilize that experience with every new system we design and install.
- Holy Angels Schoolpvt.k12.wi.us
Holy Angels School is a company based out of United States.
- Punjab Vocational Training Council - Government of Punjabpvtc.gop.pk
Punjab Vocational Training Council (PVTC) is an autonomous corporate body established by the Punjab Government through the PVTC Act of 1998. Its mission is to alleviate poverty through Zakat and private sector participation by imparting demand driven skill training and enhancing employability for disadvantaged youth.
- PVT Entertainment & Managementpvtentertainment.nl
Manager van Ivan Paulovich (winnaar So you think you can dance 2008 en bekend van The Ultimate Dance Battle), Rob van Daal (nederlandstalige zanger)
Voor boekingen van deze artiesten kunt u bij ons terecht voor meer info.
Interviews zijn alleen mogelijk op afspraak.
- PVT MANAGEMENT LLCpvtmanagementllc.com
PVT MANAGEMENT LLC, a boutique consultancy company was created to optimize and build enduring businesses through high-quality consulting services delivered with attention to detail that ensures our customers' desired outcomes are long lasting.
We work with a variety of customers whose concepts and operations are very diverse. Our customers include start-ups, emerging, expanding, and multi-unit businesses that range from retail and wholesale bakeries, cafes, fine dining, fast casual and quick service restaurants, and hybrid concepts.
- PVT Solar, Inc.pvtsolar.com
PVT Solar is the creator of the Echo solar system, a revolutionary new solar energy system that delivers more than twice as much energy as a basic solar electric (PV) system. Echo supplements conventional solar electric PV panels with a unique thermal solar technology that captures the heat from the PV panels. Echo enables homeowners to generate more of their own energy and provides electricity to run appliances, hot water for washing and bathing, thermal energy for home heating, ventilation and home cooling. For more information, visit www.pvtsolar.com
- State Border Guard Service of Ukrainepvu.gov.ua
State Border Guard Service of Ukraine is a law enforcement company based out of Calle Laguna del Marquesado Nª 19, Nave 16 Edificio Adriana 1ª Planta, Polígono Industrial La Resina (Villaverde), Madrid, Community of Madrid, Spain.
- PVUpvu.nl
PVU
Gerechtsdeurwaarders • Incasso • Legal • Opleidingen
De naam PVU staat al jaren voor hét toonaangevende kantoor voor advocatuur en bedrijfsleven in onze regio. Wij zijn een moderne organisatie op het gebied van debiteurenbeheer, minnelijke en gerechtelijke incasso en juridische dienstverlening. Zowel binnen als buiten Nederland.
Incasseren zit in onze genen.
Of het nu gaat om die ene opdracht of om grotere hoeveelheden opdrachten: het is en blijft maatwerk voor ons. U wordt begeleid door een team van goed opgeleide werknemers met lokale marktkennis. Hierdoor kunnen wij snel en effectief overgaan tot het incasseren van uw vordering. Wij brengen dagvaardingen uit, betekenen vonnissen, doen ontruimingen en leggen beslagen. Wij kunnen snel en effectief overgaan tot het incasseren van uw vordering, uw dossier is door u online te volgen via onze inzage module PVU Online.
PVU Rechtvaardig maatwerk
- Passaic Valley Waterpvwc.com
Passaic Valley Water is a company based out of Sunset St & Beverly Rd, Fairfield, NJ, United States.
- Pebble Valley Wealth Managementpvwealthmgt.com
Pebble Valley Wealth Management is an independent Registered Investment Advisor dedicated to helping individuals and small businesses achieve their financial goals by providing them with recommendations and comprehensive financial management.
Kirk Kreikemeier, CFA, FSA, is the principal and representative of the firm.
- Private Wealth Consulting Sp. z o.o.pw-consulting.pl
Firma Private Wealth Consulting to zespół doświadczonych ekspertów i ceniona na rynku europejskim firma, która specjalizuje się w zarządzaniu majątkiem. Istniejemy od stycznia 2003 roku i specjalizujemy się w nieodpłatnym doradztwie inwestycyjnym w zakresie funduszy inwestycyjnych. Posiadamy stosowną licencję Komisji Nadzoru Finansowego i działamy według zasad unijnej dyrektywy MiFID.
W tej chwili pomagamy Klientom w zarządzaniu aktywami o wartości kilkuset milionów złotych.
Ze względu na wielkość skali naszego działania oraz zaufanie naszych partnerów jesteśmy w stanie renegocjować dla Klientów opłaty i uzyskiwać wyjątkowo korzystne warunki finansowe.
Nasi doradcy to znakomici eksperci posiadający długoletnie doświadczenie na rynkach finansowych, które zdobywali w najlepszych instytucjach finansowych w kraju i za granicą. Dzięki innowacyjnym produktom, rzetelnej pracy i elastycznemu podejściu, bezpiecznie pomnażamy kilkuset milionowe aktywa naszych Klientów. Jesteśmy dumni, że 98% naszych kontaktów pochodzi z rekomendacji.
Serdecznie zapraszamy do kontaktu:
Warszawa - Centrala firmy:
Ufficio Primo
ul. Wspólna 62
00-684 Warszawa
Oddział Kraków: Oddział Wrocław:
Wawel Business Center Oławska Prestige
Pl. Na Groblach 21 ul. Oławska 9
3 piętro 3 piętro
31-101 Kraków 50-123 Wrocław
Oddział Katowice: Oddział Rzeszów:
Al. Korfantego 2 Al. Kopisto 8b
6 piętro 1 piętro, lok.509
40-004 Katowice 35-315 Rzeszów
Oddział Poznań: Oddział Gdańsk:
ul. Półwiejska 47 Al. Grunwaldzka 103 pok.5.11
61-886 Poznań 80-244 Gdańsk
- pwmcpw-medical.com
pwmc is a company based out of Canada.
- Poets & Writers, Inc.pw.org
Poets & Writers, Inc., is the primary source of information, support, and guidance for creative writers. Founded in 1970, it is the nation's largest nonprofit literary organization serving poets, fiction writers, and creative nonfiction writers. Our national office is located in New York City. Our California branch office is based in Los Angeles.
- Pratt Whitney Rocketdynepw.utc.com
Pratt & Whitney Rocketdyne delivers ground breaking engineering solutions that perform in the most extreme conditions on Earth and in space.
When it comes to extreme environments, none pose a greater level of difficulty or more varied set of challenges than the launch and operation of a system in space. With over 50 years of experience in liquid-propulsion systems and space technology, no other company has as great an understanding of those challenges as Pratt & Whitney Rocketdyne. We've fueled space-exploration missions to nearly every planet in the solar system, brought astronauts to distant places and home again, and we continue to be the nation's number one rocket engine provider.
Our unique history has led us to seek out and thrive on a wide variety of challenging projects – both in space and on the ground. We approach each with a deep commitment to problem solving and a discerning eye for innovation. We combine one of the most highly-trained workforces on Earth with our vast base of knowledge and unrivaled technical skill. We deliver zero-fail solutions that meet even the most stringent operational requirements, no matter what extremes they face.
Whether we're developing a better rocket engine, a more sustainable power solution, or a revolutionary application of existing technology, Pratt & Whitney Rocketdyne engineers the most efficient, effective and reliable solutions to any challenge.
- Palestinian Water Authoritypwa.ps
VISION
PWA overall guiding vision is:
The equitable and sustainable management and development of Palestine's water resources
MISSION
To secure an environmentally sound and sustainable development of water resources through efficient regulations and equitable water management
VALUES
The values to which PWA prescribe as guardians of the nation's water resources:
To regulate and develop water resources in a sustainable manner that reflects equality for the regional users of shared resources.
GOALS
The Goals which are set by PWA, in order to achieve the mission in accordance with the values adopted, are:
To define the optimum way to regulate, manage, protect and conserve the limited water resources as well as to optimize the benefit from water resources development by raising water consumption to levels which provide for a healthy environment and economic development.
- PWA DESIGNS LTDpwa.uk.com
PWA DESIGNS LTD is a Construction company located in 108 VICARAGE ROAD, SUNBURY-ON-THAMES, MIDDLESEX, United Kingdom.
- Prins Willem Alexanderschoolpwabarneveld.nl
Prins Willem Alexanderschool is a company based out of Netherlands.
- Prince William Area Free Clinicpwafc.org
The Prince William Area Free Clinic provides primary medical and adult dental care to indigent and uninsured residents of Manassas City, Manassas Park, and Prince William County. Services are free of charge and include diagnostic studies, specialty care and referrals, dental care, case management, patient education, medication access, and preventive care.
To be eligible for the clinic you must live in the Greater Prince William Area, be 125% of FPL and uninsured.
Please bring proof of address (state issued ID with current address in GPWA or a utility bill with you name an address on it). Please bring your proof of income as well. If you work it must be you (and your spouses as applicable) income from within the past 30 days. if you don't work we need a notarized letter of support.
To call for an appointment call: 703-496-9405 or 703-499-9191 (Spanish).
Walk-in clinics are Tuesday's for Woodbridge residents and Thursday's for Manassas Residents.
- PWApwaltd.net
Metallurgical Process and Laboratory Consultant, Process Design and Project Management
- Positive Wellness Alliancepwanc.org
Positive Wellness Alliance provides support and services to people infected with and affected by HIV/AIDS through Medical Case Management, Housing, Outreach and Preventive Education in Davidson, Davie, Forsyth, Yadkin, Rowan and Iredell Counties.
- Pwani Oil Grouppwani.net
Pwani helps its customers enjoy their daily lives in confidence:
... cooking healthily
... cleaning effectively
... washing hygienically
with great quality products at sensible affordable prices.
Based in Kenya on the shores of the Indian Ocean ('Pwani' is the Swahili word for 'Coast'); with a number of well known brands across East Africa - our mission is to be an efficient, profitable and great company to work for and to do business with. Committed to excellence: we grow our business by being Open, Honest & Fair.
We invest in technology to grow our business internationally and we invest in our staff & community. We believe it's important to make choices which protect our natural environment for future generations; and we wish our presence to be seen as ‘refining lives' of our community
www.pwani.net
- Patrick Williams & Associatespwaproperties.com
- PhiloWilke Partnershippwarch.com
The PhiloWilke Partnership was formed in 1985 on the premise that the best way to serve their healthcare clients is to provide industry-specialized design with client-specific solutions from a team of expertise-driven architects. Today, PhiloWilke continues to encompass architecture, interior design, planning and development for clients while staying true to our founding mission.
Our team has grown into a distinct organizational structure, providing the personal and specialized service of a small firm coupled with the depth of resources and experience offered by a large organization. While our core business continues to concentrate on healthcare and research architecture, our team has cultivated a diverse portfolio including science and technology, college and university, and commercial real estate projects.
- PWBApwba-architects.com
PWBA is a company based out of United States.
- PWB CPAs & Advisorspwbcpas.com
Peterson Whitaker and Bjork, LLC (PWB) is one of the top 25 CPA firms in the Twin Cities metropolitan area. Our firm, and its legacy partners, have deep roots in the community and have been serving the Twin Cities area since 1981. PWB is based in Plymouth, Minnesota with an additional office in Bloomington, Minnesota.
PWB is focused on assisting clients grow their businesses in our community. PWB brings depth, expertise and value to its clients. PWB offers a sophisticated array of services and global capabilities, combined with the personal attention of experienced and committed professionals. PWB provides services to companies that are looking for an alternative to national or 'Big Four' firms or outgrowing their local accountant. Our clients range from closely-held businesses to public companies, from individuals and partnerships to corporations, trusts and estates. PWB advisors strive to add value by understanding our client's financial needs and goals while providing forward thinking advice.
Technological enhancements have drastically changed the landscape of the financial services industry. Our advisors pursue ways to ensure our clients are utilizing the latest technologies and are able to access important financial information when they need it. Providing innovative services to our clients and responding to them in a timely manner is key to their success (and ours).
- PwC Deutschlandpwc-karriere.de
PwC US helps organizations and individuals create the value they're looking for. We're a member of the PwC network of firms in 157 countries with more than 184,000 people. We're committed to delivering quality in assurance, tax and advisory services.
- PwC Austriapwc.at
PwC ist eines der führenden Beratungsunternehmen in Österreich und unabhängiges Mitglied im weltweiten Netzwerk von PwC. Wir bieten Dienstleistungen in den Bereichen Wirtschaftsprüfung, Steuerberatung und Unternehmensberatung. Wir, das sind rund 900 Mitarbeiterinnen und Mitarbeiter in Österreich und mehr als 195.000 Menschen rund um den Erdball. Wir alle teilen unsere Expertisen, unsere Millionen Ideen und unsere gemeinsame Überzeugung: Wir wollen gewinnende Beziehungen gestalten und in der Zusammenarbeit Mehrwert schaffen.
Ob unsere Klienten nun ihre Rechnungslegung auf IFRS umstellen wollen, einen Partner für komplexe Steuerfragen suchen oder auf Expansionskurs ein Unternehmen übernehmen möchten - wir unterstützen sie dabei und bei all ihren besonderen Herausforderungen mit Wirtschaftsprüfung, Prüfung und Beratung bei Systemen & Prozessen,Steuer- und Rechtsberatung und Human Resource Services, Consulting, Krisenmanagement, Transaktionsberatung und Beratung zum Thema Nachhaltigkeit.
- PwC Belgiumpwc.be
At PwC we focus on three things: audit, tax and consulting. But we don't think ‘off-the-shelf' products and services are always the way to go. How we use our knowledge and experience depends on what you want to achieve.
So we'll start by getting to know you. You do the talking, we'll do the listening. What you tell us will shape how we use our network of 195,000 people around the world – and their connections, contacts and expertise – to help you create the value you're looking for.
Are you ready to move forward?
- Pratt & Whitney Canadapwc.ca
As a global leader in aerospace, Pratt & Whitney Canada (P&WC) is shaping the future of business, helicopter and regional aviation with dependable, new generation engines. P&WC's operations and service network span the globe. We power the largest fleet of business and regional aircraft and helicopters -- 60,000 engines in more than 200 countries and territories. P&WC is a subsidiary of United Technologies Corporation.
- PwC Switzerlandpwc.ch
We help you achieve what's important to you.
We focus on three disciplines: assurance, tax and legal, and advisory services. But how we apply our knowledge and experience depends on what you want to achieve. So whichever one of our 236,000-strong team you work with (in any of 158 countries), they'll start by asking questions. Are you looking to build trust? Create more value for your shareholders? Or do you want to do something completely different with your strategy?
We'll get to know you, your business and your goals. Then we'll share what we've learned to help you achieve them. To get started, why not call an expert at one of our 14 offices in Switzerland and one in the Principality of Liechtenstein?
- PwC New Zealandpwc.co.nz
As the future of New Zealand businesses evolves, so do we. Innovation, technology, digital and customer experience is now placed at the core of what we do.
We are committed to helping New Zealand businesses grow and with our teams of innovators, entrepreneurs, market specialists and technical experts from a variety of backgrounds, we will help you prepare for what's next, and stay ahead of our constantly changing market.
Find out more at www.pwc.co.nz.
- PwC UKpwc.co.uk
Welcome to the PwC UK Linkedin page, bringing you updates and insights from our work and our people.
We are founded on a culture of partnership with a strong commercial focus. This is reflected in our purpose: To build trust in society and solve important problems.
Overseen by our Chairman, it drives what we say and do in our everyday work by informing our choice, shaping the debates, guiding our decision-making, and inspiring us to make extraordinary efforts.
Find out more about us in our digital Annual Report here: bit.ly/1L1h6X9
- PwC South Africapwc.co.za
Biggest provider of audit, accounting and tax services to the companies listed in the Johannesburg Stock Exchange. Also provides internal audit, forensic audit, corporate finance, corporate governance services, sustainable assurance services and others.
- PwC Australiapwc.com.au
At PwC asking questions is at the heart of what we do when helping clients that range from the largest, global organisations, to governments and other not-for-profit organisations, to start-ups. We take the time to listen and understand their goals and their competitive and regulatory environment. And then we tap into our global network, deep industry expertise, and strong judgement and experience to help each client create the kind of value they are looking for.
Across our businesses, we offer a broad range of services that combine to provide our clients with a range of end-to-end solutions. From improving the structure of the Australian health system, to assuring the integrity of some of Australia's largest organisations, and helping corporations prepare a business case for sustainable operations – our teams bring a unique combination of knowledge and passion to addressing the risks and opportunities facing our community.
PwC is a remarkably diverse organisation, and one of the largest employers—and graduate recruiters—in the world. We know that to create the best value for clients, we must constantly attract and nurture the best talent. PwC is brimming with energetic and inspirational people from all backgrounds – arts, business, economics, engineering, finance, health, law – who ensure you receive the depth and breadth of insight and perspective required to negotiate an increasingly complex global environment.
- PwC Brasilpwc.com.br
PwC é um network global de firmas separadas e independentes que trabalham de forma integrada na prestação de serviços de Consultoria de Negócios, Consultoria Tributária e Societária, Auditoria e Outsourcing.
Presente no país desde 1915, a PwC Brasil possui cerca de 5.300 profissionais distribuídos em 19 escritórios em todas as regiões brasileiras.
O aspecto mais estratégico dessa estrutura pulverizada é garantir que, além da capacitação e especialização inerentes a todos os profissionais da PwC Brasil, os colaboradores regionais tenham amplo conhecimento das culturas e das vocações econômicas próprias de cada região.
- PwC Cypruspwc.com.cy
We support you to create the value you are looking for by providing specialised solutions based on quality. Together we build relationships based on trust and we say things as they are, to assist you to deal with issues that tomorrow will prove important.
We adapt the expertise of our almost 1000 professionals in Cyprus and the power of our global network of 223,000 experts in 157 countries to your specific needs, helping you make the difference.
In a demanding and challenging business environment, our diverse teams of experts are sharing deep knowledge and experience. We provide a broad range of services as listed below to meet your increasingly complex needs.
Assurance
Advisory
• Deals
• Risk Compliance & Regulation
• Business Consulting
• Sustainability & European Programmes
Tax Advisory
Indirect Tax Advisory
Legal Advisory
International Private Clients
Tax Reporting Strategy
Our industry specialisation in the following sectors, gives you the benefit of our in-depth industry knowledge and experience.
Banking
Transportation & Logistics
Retail, Consumer & Manufacturing
Hospitality & Leisure
Energy
Funds
Real Estate & Construction
Investment Firms
Insurance
Telecommunications
Visit www.pwc.com.cy to discover the benefits we can bring to you.
- PwC Turkeypwc.com.tr
PwC'de amacımız, toplumda güven oluşturmak ve önemli sorunlara çözüm üretmektir. Biz, denetim, danışmanlık ve vergi hizmetleri alanında kaliteli hizmet sunmaya odaklanmış, 158 ülkede 236.000'i aşkın çalışanın oluşturduğu bir topluluğuz. Önem verdiğiniz konuları bizimle paylaşmak ve daha fazla bilgi almak için www.pwc.com.tr sitesini ziyaret edebilirsiniz.
1981'den bu yana Türkiye'de iş dünyasına hizmet sunan PwC olarak; İstanbul, Ankara, Bursa ve İzmir'deki 5 ofisimizdeki, yaklaşık 1.700 kişilik profesyonel kadromuz ile müşterilerimizin aradığı değeri yaratmak için çalışıyoruz.
----
At PwC, our purpose is to build trust in society and solve important problems. We're a network of firms in 158 countries with more than 236,000 people who are committed to delivering quality in assurance, advisory and tax services. Find out more and tell us what matters to you by visiting us at www.pwc.com.tr
PwC has been providing services to the Turkish business world since 1981, with five offices located in four cities; İstanbul, Ankara, Bursa, and İzmir. With a professional staff of 1,700, we provide services to create the value that our clients look for.
- PwC Czech Republicpwc.cz
At PwC, our purpose is to build trust in society and solve important problems. We're a network of firms in 157 countries with more than 208,000 people who are committed to delivering quality in assurance, advisory and tax services.
PwC Czech Republic
In 1990, Coopers & Lybrand and Price Waterhouse established offices in the Czech Republic. The worldwide merger of these two organisations in 1998 created PwC. Today, PwC employs more than 1 000 employees and 26 partners in the Czech Republic. Our people, representing the cultures of 22 countries and speaking 9 languages, have the global perspective needed to solve today's complex business problems. We provide our clients - including leading multinational and domestic companies and public sector institutions - with innovative business advisory services and solutions.
Interested in careers in PwC Czech Republic? Visit www.PwCkariera.cz
- PwC Danmarkpwc.dk
PwC er et af verdens største revisions-, skatte- og rådgivningshuse. I Danmark er vi også markedsledende, og vores vision er at skabe værdi for vores relationer. I Danmark får du 1.919 kolleger, der kombinerer deres store faglighed med en stærk evne til at bygge relationer, skabe værdi og levere kvalitet. Vi er ambitiøse, og sammen inspirerer og udfordrer vi hinanden til at finde de rigtige løsninger. Med flere end 223.000 kolleger i 157 lande har du aldrig langt til viden og udvikling. Succes skaber vi sammen. Er du PwC?
- PwC Ecuadorpwc.ec
En PwC, nuestro propósito es construir confianza en la sociedad y resolver problemas importantes. Somos una red de firmas presentes en 157 países, con más de 223.000 profesionales dedicados a la prestación de servicios de calidad en consultoría empresarial y consultoría tributaria.
PwC opera en Ecuador desde 1969 con tres oficinas en las ciudades de Quito y Guayaquil en las cuales nuestros profesionales comparten su conocimiento y experiencia para crear el valor que nuestros clientes buscan.
- PwC Españapwc.es
Con más de 223.000 profesionales en 157 países -4.000 en España-, PwC es una de las redes de servicios profesionales líderes en el mundo. Nuestro propósito es generar confianza en la sociedad y resolver problemas importantes. Con casi 90 años de experiencia, PwC España está presente en 21 provincias y ofrece servicios de calidad en auditoría, asesoramiento fiscal y legal consultoría, y transacciones.
Ayudamos a las empresas a adelantarse a los cambios y a las transformaciones permanentes del entorno de los negocios. Nuestros valores definen el comportamiento de los profesionales de PwC, y se pueden resumir en cinco claves: actuamos con integridad, marcamos la diferencia, nos preocupamos por los demás, trabajamos juntos y reinventamos lo posible.
- PwC Finlandpwc.fi
Autamme yrityksiä kasvamaan, toimimaan tehokkaasti ja raportoimaan luotettavasti jatkuvasti muuttuvassa toimintaympäristössä. Palveluitamme ovat liikkeenjohdon konsultointi, yritysjärjestelypalvelut, veroneuvonta, lakipalvelut, riskienhallinta sekä tilintarkastus- ja muut varmennuspalvelut. Tarkoituksenamme on rakentaa yhteiskuntaan luottamusta ja ratkaista asiakkaidemme merkittävimpiä ongelmia.
PwC Suomi on suomalainen yritys, joka kuuluu kansainväliseen 158 maassa toimivaan PwC-ketjuun. Suomessa meitä on yli 1 000 asiantuntijaa ja toimipisteverkostomme kattaa koko maan.
- PwC Francepwc.fr
Cabinet d'audit et de conseil international, PwC compte 223 000 collaborateurs dans 157 pays à travers le monde. La raison d'être de PwC est de renforcer la confiance sur le marché économique et d'accompagner ses clients dans leurs enjeux stratégiques, à travers des missions d'audit, d'expertise comptable et de conseil (stratégie, management, transactions, juridique & fiscal). Ce qui compte pour nous, c'est avant tout votre esprit d'équipe, votre curiosité intellectuelle, votre esprit critique, votre sens de l'initiative et votre capacité d'adaptation. Nous vous proposons une évolution de carrière rapide et des opportunités de mobilité internationale dans l'ensemble des pays de notre réseau.
- PwC Greecepwc.gr
At PwC our purpose is to build trust in society and solve important problems.
We are a network of firms in 158 countries with more than 236,000 people who are committed to delivering quality in assurance, advisory and tax services. In Greece we have offices in Athens and Thessaloniki and more than 1,000 employees. Read more about us here: http://www.pwc.com/gr/about-us
Tell us what matters to you and find out more by visiting us at www.pwc.gr
- PwC Irelandpwc.ie
At PwC Ireland, helping you achieve your goals is at the heart of what we do. By listening to you and understanding your vision, we can help you overcome the challenges you face. Whether you are a large global organisation, a government body or a family owned private business, we have the experience and expertise to help you. By tapping into our global network, we can connect you with the right people at the right time. So, wherever you or your customers are in the world, we are too.
As the largest professional services firm in Ireland, we offer a broad range of services across audit, tax and advisory. So whether you are looking to keep track of the numbers, make tax simple or need help adapting to changing operating environments, we have the knowledge and capabilities to help you. Imagine what you could achieve with the expertise of more than 223,000 people from around the world across 157 countries, all of whom are committed to delivering quality and creating value for you.
PwC is a diverse organisation and one of the largest employers in the world. We know that to create the best value for clients, we must constantly attract and nurture the best talent. We have motivated and energetic people from a variety of backgrounds – arts, business, engineering, finance and law - who ensure you receive the depth and breadth of insight and perspective required to negotiate an increasingly complex global environment.
- PwC Indiapwc.in
At PwC, our purpose is to build trust in society and solve important problems. We're a network of firms in 157 countries with more than 223,000 people who are committed to delivering quality in assurance, advisory and tax services. Find out more and tell us what matters to you by visiting us at www.pwc.com.
In India, our highly qualified and experienced professionals listen to different points of view to help you solve business issues and identify and maximise the opportunities you seek. Our industry specialisation allows us to help co-create solutions with our clients for their sector of interest.
PwC has offices in these cities: Ahmedabad, Bengaluru, Chennai, Delhi NCR, Hyderabad, Kolkata, Mumbai and Pune.
- PwC Kazakhstanpwc.kz
PwC is the leading professional services organization in the world, ranking first or second in every market it operates. Drawing on the talents of more than 230,000 people in 157 countries we bring together unmatched professional knowledge and practical experience.
PwC Kazakhstan provides industry-focused assurance, tax, legal and advisory services to build public trust and enhance value for its clients and their stakeholders. There are over 500 professionals working in PwC offices in Almaty and Astana cities.
- PwC Latvijapwc.lv
Our purpose is to build trust in society and solve important problems. We're a network of firms in 157 countries with more than 223,000 people who are committed to delivering quality in assurance, tax and advisory services.
We operate in Latvia since 1993, and currently employ over 180 employees. Our goal is to contribute to the development of country's economy by advising local businesses, governmental institutions and foreign investors. Our regional practice allows us to use the most capable and experienced experts across to serve our clients in the best possible way.
- PwC Nederlandpwc.nl
Welkom bij PwC op LinkedIn! Door ons hier te volgen, blijft u op de hoogte van updates van ons bedrijf en onze mensen. Daarnaast delen we hier regelmatig interessante content, zoals onderzoeksrapporten, whitepapers en actualiteiten.
Bij PwC in Nederland werken we vanuit twaalf vestigingen. We leveren sectorspecifieke diensten en zoeken samen met onze relaties naar verrassende oplossingen. Dit doen we niet alleen voor nationale en internationale ondernemingen, maar ook voor overheden en maatschappelijke organisaties.
Geïnteresseerd in werken bij PwC? Gan dan naar www.pwc.nl/carriere
- PwC Norwaypwc.no
PwC er et revisjons-, rådgivnings- og advokatfirma som styrker kundenes styring og kontroll og legger til rette for økt verdiskaping.
I Norge utføres arbeidet av 1.700 revisorer, rådgivere og advokater ved 27 kontorer. Globalt spenner nettverket 223.000 medarbeidere i 157 land. PwC er Norges og verdens største nettverk innen profesjonelle tjenester.
Les mer om oss på www.pwc.no
- PwC Polskapwc.pl
PwC to firma działająca w 158 krajach, zatrudniająca ponad 180 tysięcy osób. Dzięki takiej różnorodności doświadczeń i szerokiej bazie wiedzy, jesteśmy w stanie pomóc naszym klientom sprostać wszelkim wyzwaniom biznesowym. Dostarczamy wysokiej jakości rozwiązania odpowiadające na problemy naszych klientów z zakresu prawno-podatkowego, biznesowego oraz audytorskiego.
W Polsce PwC zatrudnia zespół ponad 1700 specjalistów w siedmiu miastach: w Gdańsku, Katowicach, Krakowie, Łodzi, Poznaniu, Wrocławiu i Warszawie. Nasza oferta jest kierowana do firm działających we wszystkich sektorach gospodarki – zarówno do największych koncernów, jak i lokalnych przedsiębiorstw rodzinnych.
- PwC Portugalpwc.pt
As firmas da PwC colaboram com organizações e pessoas na criação do valor que procuram. A PwC, uma network constituída por firmas independentes entre si, está presente em 157 países e conta com cerca de 223.000 colaboradores que partilham o objetivo de prestar serviços de qualidade em auditoria, consultoria e fiscalidade.
A PwC em Portugal, Angola e Cabo Verde conta com 35 partners, dos quais 22 no escritório de Lisboa, 9 no Porto e 4 em Luanda, e cerca de 1.300 colaboradores permanentes distribuídos pelos escritórios de Lisboa, Porto, Luanda e Praia. A grande maioria dos profissionais é licenciada em gestão de empresas, finanças, economia, contabilidade, direito, engenharia ou ciências sociais, a todos sendo proporcionada a hipótese de complementarem a sua formação académica, além de receberem frequentemente formação profissional específica.
O Presidente (Territory Senior Partner) é José Manuel Bernardo. Fazem ainda parte da Territory Leadership Team, Aurélio Amado (Deputy Senior Partner), Maria Antónia Torres, Jorge Figueiredo e Patrique Fernandes. Ana Lopes é responsável pela área de Assurance, Patrique Fernandes pela área de Advisory, Jaime Esteves pela área de Tax e Ricardo Santos tem a responsabilidade de Country Senior Partner em Angola.
- PwC Romaniapwc.ro
PwC helps organisations and individuals create the value they're looking for. We're a network of firms in 158 countries with more than 236,000 people who are committed to delivering quality in assurance, tax and advisory services. Tell us what matters to you and find out more by visiting us at www.pwc.ro.
PwC refers to the PwC network and/or one or more of its member firms, each of which is a separate legal entity. Please see www.pwc.com/structure for further details.
'PwC' is the brand under which member firms of PricewaterhouseCoopers International
Limited (PwCIL) operate and provide services. Together, these firms form the PwC network. Each firm in the network is a separate legal entity and does not act as agent of PwCIL or any other member firm. PwCIL does not provide any services to clients. PwCIL is not responsible or liable for the acts or omissions of any of its member firms nor can it control the exercise of their professional judgment or bind them in any way.
This content is for general information purposes only, and should not be used as a substitute for consultation with professional advisors.
- PwC Serbiapwc.rs
PwC Serbia was established in Belgrade in 2001. By providing our Assurance, Advisory, Tax and Legal services we help our clients solve complex business problems and measurably enhance their ability to build value, manage risk and improve performance.
PwC Serbia is a part of the global PwC organisation with member firm offices in 736 locations throughout 158 countries, employing over 236,235 people worldwide.
Our Belgrade office is currently employs 200 people, both locals and expatriates. Engagements in Serbia are generally staffed by a combination of local specialists, with knowledge of local conditions and regulations, and international consultants, with expertise in tackling issues faced by international enterprises and also practice in dealing in the Serbian environment.
PwC refers to the PwC network and/or one or more of its member firms, each of which is a separate legal entity. Please see www.pwc.com/structure for further details.
'PwC' is the brand under which member firms of PricewaterhouseCoopers International
Limited (PwCIL) operate and provide services. Together, these firms form the PwC network. Each firm in the network is a separate legal entity and does not act as agent of PwCIL or any other member firm. PwCIL does not provide any services to clients. PwCIL is not responsible or liable for the acts or omissions of any of its member firms nor can it control the exercise of their professional judgment or bind them in any way.
This content is for general information purposes only, and should not be used as a substitute for consultation with professional advisors.
- PwC Russiapwc.ru
PwC is the leading professional services organization in the world, ranking first or second in every market it operates. Drawing on the talents of more than 195,000 people in 157 countries we bring together unmatched professional knowledge and practical experience.
PwC Russia provides industry-focused assurance, tax, legal and advisory services to build public trust and enhance value for its clients and their stakeholders. There are over 2,600 professionals working in PwC offices in Moscow, St. Petersburg, Ekaterinburg, Kazan, Rostov-on-Don, Krasnodar, Voronezh, Novosibirsk, Yuzhno-Sakhalinsk and Vladikavkaz.
Our clients in Russia:
• 10 out of the 10 largest banks and financial services firms
• 9 out of the 10 largest oil and gas companies
• 8 out of the 10 largest power sector companies
• 8 out of the 10 largest retail companies
• 8 out of the 10 largest metallurgical companies
• 5 out of the 6 largest telecommunications providers
• 4 out of the 9 largest mining companies
Our achievements:
In 2014, PwC Russia received the award for "Best in Class – Audit" in the Universum Top 100 Best Employers rating
In 2013, PwC Russia received an International Sports Event Management Award in the category of "Best Use of Sponsorship" for its Kazan 2013 Universiade partnership programme
In 2013, PwC Russia was named a laureate in the category "Economic Prosperity" of the Sochi 2014 "Gateway to the Future" Sustainability Awards
In 2013 PwC Russia was ranked 1st among major audit and consulting groups in Russia according to the Expert RA ratings agency
In 2012 the Russian Union of Industrialists and Entrepreneurs (RSPP) awarded PwC Russia for its contributions to corporate philanthropy in the country
Kommersant and Legal 500 ratings recommend PwC Legal as one of Russia's leading law firms
- PwC Swedenpwc.se
PwC Sverige är marknadsledande inom revision, redovisning, skatte- och affärsrådgivning med 3 700 medarbetare på 100 kontor runt om i landet. Med erfarenhet och unik branschkunskap utvecklar vi nya perspektiv och ger värdefulla råd för våra 50 000 kunder som omfattar allt från internationella storföretag till småföretag samt alla typer av organisationer och verksamheter inom offentlig sektor. PwC Sverige delar kunskaper, erfarenheter och lösningar med 223 500 medarbetare i 157 länder inom det globala PwC-nätverket.
- 資誠 PwC Taiwanpwc.tw
資誠(PwC Taiwan)創於1970年,四十多年來伴隨台灣經濟發展業務不斷蓬勃成長,目前在台灣已有8個服務據點,超過2,700位專業人才。
資誠提供產業專精的整合性專業服務,包括審計、稅務、投資理財顧問、價值管理、人力資源整合管理、法律等服務,服務對象涵蓋跨國及國內企業,透過密切的互動與合作,提供全面與完整的解決方案,以提升客戶價值。
資誠為PwC在台灣之聯盟所。PwC集合158個國家中超過236,000專業人士的集體智慧與專業技術服務,在世界各地分享他們的思維、經驗及解決方案,以發展各方面嶄新的見解。資誠長期以來深入觀察各種產業,運用PwC全球資源,協助客戶精準掌握全球最新經濟產業趨勢。
PwC Taiwan聲明:
本專頁中粉絲或網友所張貼或回應之任何內容,不代表PwC Taiwan之立場,倘其內容包括(但不限於)任何誹謗、侮辱、具威脅性、攻擊性、不雅、猥褻、不實、違反公共秩序或善良風俗或其他不法或不當之文字、圖片、附件及超連結等,皆應由其自負相關法律責任,PwC Taiwan並保留移除該等內容之權利。
PwC Taiwan針對本專頁內容之正確性、及時性與完整性並無任何明示或默示之聲明或保證,所張貼之內容屬相關主題一般及概念性之介紹,僅供參考,並不構成PwC Taiwan對於特定財務、稅務及法律案件等特定議題之意見。讀者或他人就特定事件,仍應諮詢或尋求專業建議,不應援引本專頁之內容以作為任何權利或利益之主張,如讀者或他人逕依本專頁內容而為任何決策或決定,PwC Taiwan對於因此而產生之任何結果,概不負責。
© 2017 PwC Taiwan版權所有。「PwC」係指PricewaterhouseCoopers International Limited組織成員所構成的聯盟組織,每一成員均是個別及獨立的法律個體。
PwC Taiwan was established in 1970. The firm grew rapidly over the ensuing decades and now has 8 offices and more than 2,700 distinguished and dedicated business professionals. PwC Taiwan provides industry-focused assurance, tax, investment consultant, evaluation, human resources management, and legal advice, etc, to enhance value for our clients.
PwC Taiwan refers to the network of member firms of PwC International Limited. Across this network, more than 236,000 people in 158 countries share their thinking, experience and solutions to develop fresh perspectives and practical advice. With PwC's global resources at its disposal, PwC Taiwan follows the world's major industries constantly, helping clients tap into the latest economic trends and industry developments.
- PWC Avispwcavis.sk
Our company, PWC Avis, s.r.o. was established on purpose of development and support of customer specific and complex software solutions focused on military applications, mainly on solutions for air force services.
- PwC Société d'Avocatspwcavocats.com
PwC Société d'Avocats est, en France, membre de PricewaterhouseCoopers International Limited, société de droit anglais, et appartient au réseau international d'entités françaises et étrangères exerçant leurs services professionnels sous la marque PwC, présent dans plus de 158 pays et fédéré par des valeurs partagées par l'ensemble de ses membres.
Le réseau international des entités membres de PricewaterhouseCoopers International Limited exerçant leurs services professionnels sous la marque PwC, un des leaders mondiaux du conseil aux entreprises garantit à ses clients à la fois les moyens et la puissance d'une organisation mondiale, mais aussi la compréhension et la prise en compte de différences économiques ou culturelles locales. Ses collaborateurs, avocats en droit international comme avocats fiscalistes, partagent points de vue, expériences et solutions pour proposer des perspectives innovantes et des conseils adaptés à chaque situation particulière.
Une société d'avocats apte à répondre aux nombreuses problématiques de ses clients.
La pluri-disciplinarité de notre société d'avocats permet une approche globale des problématiques de nos clients. Nous disposons en effet d'expertises complémentaires en fiscalité, droit des affaires et droit du travail que nous combinons si nécessaires avec celle des autres métiers de PwC : Audit et expertise comptable, ainsi que conseil en stratégie, en management et en transactions.
Notre société d'avocats s'appuie également sur des expériences sectorielles fortes dans les principaux secteurs d'activité des acteurs du marché, en coordination avec les vingt pôles de spécialisation sectorielle de PwC.
La dimension internationale de PwC Société d'Avocats, combinée à son implantation régionale, permet à notre société d'avocats de s'adapter de façon pertinente aux besoins spécifiques de nos clients.
- Prince William Countypwcgov.org
Prince William County government is an organization where elected leaders, staff and citizens work together to make Prince William County a community of choice where: individuals and families choose to live and businesses choose to locate; employees pledge to do the right thing for the customer and community every time; and we, as a learning organization, commit to provide the necessary support and opportunities for each employee to honor this pledge. We live our values of respect, integrity, creativity, teamwork, excellence and responsibility.
Prince William County government is more than 4,000 employees strong. We offer growth opportunities in a variety of fields with competitive pay, a great learning environment and excellent benefits. Everything from archeologists, web developers, park rangers, police officers and firefighters and much, much more, we have a satisfying career right here for you.
- PwC Hong Kong and Mainland Chinapwchk.com
PwC in Mainland China, Hong Kong and Macau work together on a collaborative basis, subject to local applicable laws. Collectively, we have around 600 partners and a strength of around 15,000 people.
Providing organisations with the advice they need, wherever they may be located, our highly qualified, experienced professionals listen to different points of view to help organisations solve their business issues and identify and maximise the opportunities they seek. Our industry specialisation allows us to help co-create solutions with our clients for their sector of interest.
We are located in these cities: Beijing, Shanghai, Hong Kong, Shenyang, Dalian, Tianjin, Qingdao, Nanjing, Suzhou, Hangzhou, Ningbo, Wuhan, Changsha, Xi'an, Chengdu, Chongqing, Xiamen, Guangzhou, Shenzhen, Macau.
- PwC Legal Austriapwclegal.at
Business and legal issues today are intertwined as never before. So, doesn't it make sense to work with a legal network whose services are embedded within the powerful capabilities and broad client footprint of a global professional services leader? With over 3,500 lawyers across more than 90 countries, we have the broadest geographical coverage of any Legal Services network in the world.
In Austria, PwC Legal operates through oehner & partner rechtsanwaelte gmbh, an independent Austrian law firm. For details please see www.pwclegal.at.
- Professional Wireless Communicationspwcmn.com
Since 1998, Professional Wireless Communications has been providing radio communications solutions to the Twin City metro area. We have helped businesses bridge the communications gap through the use of two-way radio and related equipment. Areas of specialty include:
•Two-Way Radio Sales, Service, and Rental
•Digital Radio Solutions
•Wide area Radio Dispatch
•Repair - Warranty and Non-Warranty
•On-site installation and repair
•Dispatch Consoles
•Building Coverage Solutions
•Wireless Headsets
Call us to find out what we can do to help your business keep in contact! 952-746-2500
- Perelson Weiner LLPpwcpa.com
Perelson Weiner LLP is a certified public accounting firm offering comprehensive tax, accounting and auditing, litigation support, valuation and business consulting services. Combining expertise and personalized attention, the Firm focuses on assisting entrepreneurs and owner-manager businesses to optimize profitability and growth, and non-profit organizations and foundations to carry out their mission. Complementing the client service process, the Firm provides estate, gift, financial and wealth planning services for high net worth individuals and families. Our experience, insight, knowledge and commitment allow us to meet the unique needs of each of our clients.
- Port Waratah Coal Servicespwcs.com.au
Port Waratah Coal Services have been receiving, stockpiling, blending and loading coal for export in the Port of Newcastle for 40 years. We own and manage the Kooragang and Carrington Coal Terminals, with a combined capacity of 145 million tonnes per annum (mtpa). We have approximately 350 employees working across our business, operating our terminals 24 hours per day, 7 days a week.
We pride ourselves on our ability to adapt to meet the needs of customers by innovating new ways of working. Health, safety, environmental, social and economic aspects are integrated throughout our decision making, activities and processes. This means that we continuously strive to understand and fulfil our responsibilities as an employer and community member, as well as meet our legal obligations.
Our operations play a vital role as a conduit between the Hunter Valley and the world. We don't buy or sell coal. We don't own or manage the mines, the railways or the vessels. We are a local business who provides services to the local coal industry.
To learn more about our operations or employment opportunities please visit our website.
- Prince William County Public Schoolspwcs.edu
Prince William County Public Schools (PWCS) provides a 'World-Class' Education to more than 89,000 students in 100 schools and centers in Northern Virginia, just 25 miles southwest of Washington, D.C. Known for its system of school-based management, which emphasizes decision-making and accountability at the school level, each PWCS school has its own unique character while pursuing the common goal to provide a World-Class Education to every student. Students and staff benefit from innovative instructional and professional learning programs, specialty programs (K-12) and career paths, resulting in continuous growth each year.
PWCS Connect, our leading induction and mentoring system, combines orientation and on-boarding, one-on-one mentoring, support from a team of master educators at the school level, and ongoing job-embedded and Division-level professional learning to provide strategic, tiered support for beginning educators. Our family of employees benefit from extensive professional learning opportunities, tuition reimbursement, comprehensive benefits options, and many other incentives in a School Division that continues to hire hundreds of professional educators each year.
View all vacancies at https://jobs.pwcs.edu/Jobs/ . Visit the Department of Human Resources at https://www.pwcs.edu/cms/One.aspx?portalId=340225&pageId=653790 .
Visit us on Facebook: www.facebook.com/PWCSCareers/ or Twitter @PWCSRecruit.
Feedback from our recent hires:
'I felt like I was wanted, accepted, and appreciated...I felt like I could truly make a difference here...I fell in love with everything I saw!' -2017-18 New Teacher
'PWCS was a clear choice for me. I wanted to work in a district that offered world-class learning experiences for students, yet also provided personalized experiences and help for students and employees. PWCS is the only district in the area with small-town feel and big city drive.' -2017-18 New Teacher
- Prince William County Service Authoritypwcsa.org
The Prince William County Service Authority is the premier provider of safe, reliable drinking water and environmentally-sound water reclamation services to more than 300,000 customers in Prince William County, Virginia.
The high quality drinking water the Service Authority provides is drawn from three primary sources: the Occoquan Reservoir, Potomac River and Lake Manassas. Water from the Occoquan Reservoir and Potomac River is treated at Fairfax Water's Frederick P. Griffith, Jr. and James J. Corbalis, Jr. Water Treatment Plants, respectively. Water from Lake Manassas is treated by the City of Manassas.
Wastewater from the Authority's service area is treated at two different facilities in Northern Virginia. The H.L. Mooney Advanced Water Reclamation Facility in Woodbridge treats wastewater from the eastern portion of the County. The Upper Occoquan Service Authority in Fairfax County treats wastewater from western Prince William County.
Learn more at www.pwcsa.org.
- Portland Water Districtpwd.org
Portland Water Distrect is a quasi-municipal district in the Greater Portland, Maine area. It provides water supply and water distributtion services for 11 communities and wastewater interception, treatment and contract operations of municipal sewerage and storm drainage facilities for several of the 11 municipalities in our chartered Greater Portland service area.
- People With Disabilities Foundationpwdf.org
Our Mission is to provide education and advocacy for people with psychiatric and/or developmental disabilities, with or without physical disabilities, so that they can achieve equal opportunities in all aspects of life.
We have two major program components: Advocacy and Education/Public Awareness.
ADVOCACY SERVICES
Legal representation for SSI, Social Security Disability, and disability work incentive programs hearings and appeals.
Litigation
Referral Services
Legal consultations on: Employment (including ADA reasonable accommodations), Health Care (including Medi-Cal and Medicare), SSA Work Incentive Programs, and Post-Secondary Education
EDUCATION AND PUBLIC AWARENESS SERVICES
We host seminars in the Bay Area on such disability-related topics as employment, Social Security, housing, post-secondary education, health care, and multiculturalism.
We produce and distribute training materials including videos (DVD and VHS) and CDs. Our most recent training video, 'Understanding Employees and Job Applicants with Psychiatric Disabilities' (2008), addresses psychiatric disabilities in the workplace from a medical and vocational perspective, and comes with a workbook for usage in group training situations. 'Understanding' is a valuable tool for Human Resources managers, Vocational Rehabilitation counselors and other organizations and professionals working with or on behalf of people with psychiatric disabilities.
We can provide Guest Speakers on a range of topics related to disability.
Trainings on-site at your organization can be arranged on a variety of disability-related subjects.
Please visit our website for further details on our services.
- PWFpwf.com.au
PWF (Property Wealth Finance Pty Ltd) is a privately-owned Australian company with offices in Queensland and Western Australia, with expansion underway into Victoria and New South Wales. The company was established in Brisbane in 2004.
The company's overall mission is to help our clients find financial freedom sooner. This specifically includes mortgage and debt reduction, strategies to minimise tax, and help with replacing their income in retirement – all as part of a wealth creation plan.
PWF's specialist divisions are designed to work together to form a seamless source of help for clients' financial life. The team diligently helps clients with every step of their financial plan, becoming lifelong mentors to them.
- P W Greenhalghpwgreenhalgh.com
P W Greenhalgh is a company based out of United Kingdom.
- Pocatello Women's Health Clinicpwhc.net
- Prince William Home Improvementpwhomeimprovement.com
Prince William Home Improvement was established by Scott Holtzhauer, in 1986, to serve the remodeling needs of the Northern Virginia area. Originally specializing in vinyl siding and vinyl replacement windows, Prince William Home Improvement has grown into a full service-remodeling firm that also furnishes and installs decks, roofing, kitchens and baths.
•Since 2000, Prince William Home Improvement has been ranked as one ot the top 500 contractors in the United States by Qualified Remodeler Magazine. In 2009 Prince William Home Improvement was ranked number 83 nationally, out of over 800,000 home improvement companies. Beginning in 2003, Replacement Contractor Magazine has ranked
•In 2008, Prince William Home Improvement was selected by Associated Materials, Inc. to be the exclusive dealer of the award winning Evolution Vinyl Siding and Evolution Vinyl Replacement Windows. Evolution's intensive research and development result in products with unsurpassed beauty and uncompromising quality that customers demand.
•In 2009 Prince William Home Improvement received the Trex Pro Elite award for decking and is one of only 12 contractors honored with that award in the nation. Prince William Home Improvement also serves on the advisory board for Trex.
Prince William Home Improvement Mission Statement
To provide our customers the highest quality product, the best customer service and to be the overall leader in value in the home improvement industry.
- PWI Sistemaspwi.com.br
Vivendo tecnologia: criando soluções!
Fundada em 1987, a PWI (Password Interativa Sistemas LTDA.) trabalha em parceria constante através de uma atuação planejada e personalizada para cada realidade de seus clientes. A PWI analisa suas necessidades de forma integral, assessorando-os desde a montagem ou atualização da estrutura física (Hardware, Rede, etc.) até o desenvolvimento de sistemas sob medida, sempre com suporte técnico constante. Nossas soluções buscam oferecer ferramentas em informática que permitam à empresa melhorar os seus processos administrativos e produtivos, tornando-a mais competitiva e ágil, acompanhando com dinamismo as exigências do mercado.
- PWI GROUP PTY LTDpwigroup.com.au
PWI Group is a global real estate agency specialized in residential and commercial real estate services, based in the heart of Sydney CBD. It is recognized as leaders within the Australian real estate market.
- Precision Wires India Limitedpwil.net
Precision Wires India Limited is the largest manufacturer of Copper Winding Wires in India. Products manufactured include Round wire, Rectangular wire, Continuously Transposed Conductors and Paper Insulated Copper Conductors. These are widely used by the electrical and electronics industry across the globe.
- PWIP Designpwipdesign.com
For over 9 years, we've been committed to create experience and innovative solutions that transform brands, grow businesses and make people's lives better. Building brands and driving sales with powerful ideas.
We believe that 'Perception is Reality' and work hard to make sure your target audience is presented with the perception you need to be successful.
Our experience with various industries is broad and diverse, giving us the upper hand capability and intelligence to effectively make you stand out over your competitors.
- PWI Engineeringpwius.com
PWI is a mechanical, electrical, plumbing and fire protection engineering firm since 1936 in the Philadelphia area. Our specialty is designing Combined Heat and Power (CHP) Plants. Our markets are in Healthcare, Higher Education, Commercial, and Industrial Facilities, and Energy Planning & Management Consulting.
We are an energy broker in New Jersey and Pennsylvania and provide energy services such as:
Energy Procurement, Strategic Energy Planning, Incentive Management, Energy Risk Management and Environmental Services.
Our office locations are in Cherry Hill, New Jersey and Jenkintown, Pennsylvania.
- Worrall Lawyerspwl.com.au
Our Firm is a leading provider of specialised legal services in Tasmania. We provide independent, confidential and professional advice to private clients in estate planning, wills, probate, advice to executors, advice to beneficiaries, family law, migration law, taxation law, commercial law, conveyancing and other aspects of property law. We provide exceptional service levels, quality legal advice, and practical solutions to our clients. We tailor solutions to meet clients' unique and individual legal needs.
Our People are highly trained. We specialise in what we do. We are a niche practice. We do not dabble in areas of the law in which we do not generally practice - although we are happy to refer our existing clients to other lawyers in areas in which we do not practice. Our people are committed to our firm values of service, quality and problem solving.
- Pereira Walter Lawyers LLPpwlaw.ca
Pereira Walter Lawyers LLP is a Law Practice company located in 201 City Centre Dr, Mississauga, Ontario, Canada.
- Power Light Tech Limitedpwled.com
Power Light Tech Limited is established as a High-Tech LED lighting company with headquarter based in one of the fastest growing cities - Shenzhen, China. Our company focus on LED lighting technology research and development. We provide a wide range of high quality LED lighting products. And our company has an enthusiastic and passionate technical team of professionals with products, including strip lights, LED wall washer lights,LED fluorescent years of experience on LED lighting technology and products.
Power Light Tech Limited is the most reliable Asian supplier of low voltage and energy saving led light products, including residential and out door led lighting. The mainly products from PWLED are LED spotlights, LED bulb lights, LED downlights, LED strip lights, LED wall washer lights,LED fluorescent lamps T8 T5,ETC.
PWLED welcomes all kinds of inquiries. Please do not hesitate to contact us, as our customer service team will keep all your words as precious customer feedback. The quality and service are guaranteed atPWLED. Choose PWLED, and you are choosing the satisfaction. Please contact us now.
- PWMpwm.com.pl
PWM is a company based out of Poland.
- Prince William Marine Salespwmarina.com
Welcome to Prince William Marina; Sea Ray Sales, Service, Parts & Lifestyle! Located on the Occoquan River with a family friendly atmosphere. When you purchase a boat from us, you don't just get a boat, you get a part of us because 'We Care'. We are actively involved in every aspect of the business. We try to make your boating experience happy and trouble free. The Prince William Marina family looks forward to serving you and showing you how 'We Care'.
Join the Conversation at
facebook.com/pwmarina
twitter.com/pwmarina
- Petone Clubpwmc.co.nz
The Petone Working Men's Club is a private social club that was established in August 1887 to provide recreation and education for working class men and their families. The Club holds a prestigious Queens Charter and after 128 years we are still going strong and have an ever expanding membership.
Though steeped in tradition the Club has undergone a $3 million dollar revamp including extensive alterations to the Bar, Bistro, Restaurant and Garden Bar facilities. The Petone Working Men's Club is a multi award winning venue and pride ourselves as the main entertainment hub within the community.
We love to support our local community. Do you know a local sports club or team, community group, kindergarten, school, or an outstanding individual who needs support? We Would Like to Help! We have lots of ways of supporting our community, from sponsorship to fundraising events. Contact Club reception for more information.
The Petone Working Men's Club is a non-profit organisation run through a committee, elected biannually. The club has rules that are enforced to ensure the club remains a fantastic place to be. Despite the name, women are always welcome to join the club and non-members can be signed in by a member.
- Printworks Mediatech L.L.C.pwmtdubai.com
Printworks Mediatech is the result of a joint venture between two well established and reputed companies.
Mediatech is a Dubai based company that started operating in 1993 and was one of the leading prepress companies in the Emirates . It has a long lasting tradition of excellence and the most experienced employees in the business. It launched an indoor digital printing department in 2000.
Printworks is the leading digital printing company in Lebanon. It started operating in 1999 and is specialized in turnkey solutions including indoor and outdoor printing, fabrication, installation,flag and textile printing.
Printworks Mediatech is now offering all the above stated services. It is based in Deira and includes over hundred & fifty qualified employees who are dedicated to providing you with the utmost reliability, standards and service.
Printworks Mediatech is the "one-stop-shop for all your digital printing needs. Digital Printing is a process of printing without the cost and requirements of films & plates. It enables us to produce high quality prints in low volumes. Digital Printing is aptly described as "print on demand": print only what you need, when you need it.
There are several types of Digital Printing currently available:
Water Base Printing (WBP) for indoor and outdoor use
Solvent Base Printing (SPB) for long-term outdoor use and oversized graphics
Flag & textile printing
UV Printing on rigid material
- Pharmacy WebMart Wholesalepwmwholesale.com
Pharmacy WebMart Wholesale are a major player in the Global business-to-business pharmaceutical market, providing both Ethical Drug lines and over-the-counter general sales lines to Pharmacies, Hospitals, Care Facilities and Government Institutions.
We are sincerely committed to providing the absolute best in customer service, cost effective pricing and rapid delivery. We genuinely care about the end results of our endeavors, the patients and customers you serve.
Pharmacy WebMart Wholesale has a wide product range, with access to 300,000 lines of quality medicines, from over 230 reputable suppliers.
At PWM Wholesale we are strategically positioned to offer our products at well below average Wholesale prices.
We're a highly service-oriented, discreet and privately owned company, that has been operating out of New Zealand for over 20 years.
We guarantee to source you quality branded medicines at highly competitive prices.
- PWNpwn.nl
PWN staat voor zuiver en betrouwbaar drinkwater en het beheer van grote natuurgebieden, waaronder een grote drinkwatervoorraad is opgeslagen. PWN is een nutsbedrijf met circa 500 medewerkers, dat jaarlijks circa 104 miljoen kubieke meter drinkwater tegen kostprijs levert aan 750.000 aansluitingen bij particulieren, bedrijven en instellingen. Het hoofdkantoor staat in Velserbroek; waterzuivering vindt plaats in Andijk, Heemskerk, 't Gooi en in het duingebied. PWN wordt wereldwijd erkend als innovatief bedrijf dat nieuwe zuiveringstechnieken ontwikkelt. PWN innoveert ook in natuurbeheer, met name in dynamisch duinbeheer en begrazingsprojecten. PWN beheert in totaal 7300 hectare aan natuurgebieden tussen Bergen en Zandvoort. Recreanten bezoeken deze gebieden zeven miljoen keer per jaar.
Bron: PWN
afd. Marketing en Communicatie
- PWN Globalpwnglobal.net
PWN Global is a For Purpose dynamic fast-growing offline and online networking and leadership development platform for professional women of all sectors and industries. With over 3,500 members and more than 90 nationalities, our volunteer-led organisation delivers over 600 events a year in our community of 24 city networks. We welcome you to our events; as a mentor or mentee; to explore our rich knowledge and resources; to learn, grow and leave your legacy, whilst volunteering across the Federation and our City Networks.
WHAT WE STAND FOR: ADVANCING WOMEN IN LEADERSHIP. Leveraging 100% of the world's talent will result in an economically sustainable, happier society. Gender balanced decision making creates strength of character, resilience and growth. We aspire to accelerate the pace of change and to inspire our community to embrace new skills and put reforms into action.
WHO WE IMPACT: MEMBERS-women and men, their FAMILIES, corporate PARTNERS, other collaborative networks and forums. Our stakeholders openly commit to being ambassadors of gender balanced leadership, to put promises into action and to create business impact.
HOW WE IMPACT OUR COMMUNITY: Sharing KNOWLEDGE, BEST PRACTICES and TOOLS to support our members. Our mentors, development programmes and Networks help to break down the barriers to women's progress whether self imposed, organizational or cultural.
OUR COMMUNITY: COURAGEOUSLY SPEAKS UP and proudly puts our values into practice in their own organizations.
- PWNK Digitalpwnkdigital.com
We are a fresh Creative Development Agency based in North London, specialising in Web Development, Online Advertising, Prototyping, and Games.
- Parrillo, Weiss & O'Halloranpwolaw.com
Parrillo, Weiss & O'Halloran provides full service representation. We are an aggressive firm of trial lawyers that specialize in defense and insurance-related litigation while maintaining a healthy balance of plaintiff personal injury and other cases. Our lawyers are experienced in the handling of most types of litigation and have offices in Chicago, Boca Raton, FL and Phoenix, AZ.
- Perella Weinberg Partnerspwpartners.com
At Perella Weinberg Partners, we provide one service: trusted advice.
As a leading independent advisory firm, we devise creative solutions to clients' most complicated strategic problems. We believe nothing is unsolvable. Since we started the firm in 2006, our focus has remained steadfast – help clients make strategic and alternative investment decisions based on diverse, informed perspectives. Our team of 650 professionals serves our clients from offices in nine cities around the world, including New York, Houston, London, Abu Dhabi, Denver, Dubai, San Francisco, Calgary, and Los Angeles. More about our firm can be found at www.pwpartners.com.
- Peter White Public Librarypwpl.info
The Peter White Public Library is a public library located in 217 N Front St, Marquette, Michigan, United States.
- PWP Landscape Architecturepwpla.com
Founded in 1983, Peter Walker and Partners (PWP) is an employee-owned firm located in Berkeley, California, comprised of approximately 30 landscape architects who work worldwide on a variety of projects. The partners, associates, and staff bring a range of interests and expertise together around our shared ambition to create legible, beautiful, and enduring places.
- pwpwplasticos.com
pw is a company based out of Brazil.
- Pleasant View Gardenspwpvg.com
Pleasant View Gardens in Loudon, New Hampshire is one of the founders of PROVEN WINNERS, the number one plant brand in North America. As a wholesale grower of both young plant liners and ready-to-sell flowering potted annuals, perennials, and shrubs, PVG's customers include greenhouse growers, garden centers, and landscapers across North America.
We believe that your success depends on more than just the highest quality plants. You also need a supplier committed to delivering uncompromising service and support. Building a relationship with you. And being attentive enough to anticipate your every need.
At Pleasant View Gardens, we start with an incredibly diverse selection of healthy plants and plant material -- from breathtaking annuals, ornamentals, and shrubs to herbs, edibles, succulents, and more. All grown to our exacting, high-quality standards and backed by innovative solutions and flexible, personalized service. Since 1976, we've built our reputation on going the extra mile to help customers of every size become more profitable and successful. Today, we're ready to do the same for you.
- PWPW S.A.pwpw.eu
Polish Security Printing Works (PWPW) is a company with over 90 years of experience as a producer on the securities market.
Our mission:
'Our products and services ensure reliability of transactions and identification processes'
We offer our customers modern, well-secured products and high quality services. These include: banknotes, securities, documents, excise tax bands and postal stamps, as well as plastic cards and electronic services.
- Pharmacy Wholesalers Russells (PWR)pwr.co.nz
- Akademickie Radio LUZpwr.edu.pl
Akademickie Radio Luz to niekomercyjna rozgłośnia akademicka Politechniki Wrocławskiej. Wspieramy rozwój młodych i ambitnych ludzi. Wspólnie tworzymy oryginalne radio bliskie studentom i kulturze.
Tygodniowy program to 14 godzin bloków spikerskich dziennie.
Współpracujemy z większością instytucji kulturalnych, sportowych i rozrywkowych w mieście, patronujemy kilkunastu wydarzeniom różnego typu tygodniowo. Bilety do kina, teatru, na koncert czy imprezę, karnety gastronomiczne, sportowe – te i wiele innych możesz zdobyć dzięki zabawom i innym materiałom dźwiękowym, tworzonym przez niestrudzony dział techniki.
Bloki wypełnione są muzyką dla odbiorców 'z otwartą głową i uchem', która w tak eklektycznej mieszance nie pojawia się nigdzie indziej. Cechuje nas otwartość na nowe muzyczne zjawiska i trendy, jak również chęć grania jak najszerszego, różnorodnego spektrum muzycznego – zarówno jedno, jak i drugie realizowane jest przez rotację, płyty tygodnia i mocograje, ale także w dużej mierze przez selekcję muzycznych audycji autorskich i półautorskich.
Staramy się tworzyć radio niezależne i oryginalne.
Akademickie Radio LUZ należy do grupy Polskie Rozgłośnie Akademickie.
-----
Academic Radio Luz is a non-commercial academic radio station Wroclaw University of Technology. We support the development of young and ambitious people.Together, we create original radio close to students and culture.
We work with the majority of cultural institutions, sports and entertainment in the city, patrons of several various weekly events.
The blocks are filled with music for the audience ' with an open mind and ear ,' which in such an eclectic mix does not appear anywhere else. We are characterized by openness to new musical phenomena and trends, as well as the desire to play the widest, diverse musical spectrum.
We're trying to create radio which is independent and original .
Academic Radio LUZ belongs to a group of Polish Academic Broadcasters .
- Paull & Warner Resourcespwr.net.au
PWR (Paull and Warner Resources) offers its clients a completely integrated suite of services focused on the clients ER, equipment, training and personnel needs.
The unique service and product range is delivered by a highly qualified PWR team who have proven themselves to be industry leaders in risk management, training and providing emergency services personnel.
PERSONNEL
We currently have the following personnel on sites around Australia :
Security Officer
Emergency Services Officers
Industrial Medics
Remote Area Nurses
Safety Advisors
Risk Management Specialist
EQUIPMENT
PWR has an extensive fleet of emergency response vehicles, response equipment and access equipment to assist sites during servicing, project work, shutdown PPE support or training programs.
Emergency response vehicles
Emergency response equipment and packages
Perth based training facilities – including confined space and rope rescue centre
Medical facilities and emergency response ready rooms
Medical supplies
TRAINING
PWR under agreement with GETS (RTO No. 51837) is able to deliver Nationally accredited training across Australia. We use the latest equipment and training techniques at our Perth training centre, on our mobile training units and on client sites.
Some of the courses we offer include :
Industry Emergency Response (Cert III Response & Rescue, Public Safety Cert II & III)
Cert IV in HealthCare (Ambulance)
Industry Workplace Safety
- Perfect World Co., Ltd.pwrd.com
About Perfect World
Perfect Word is a company of online game research and development, operation, marketing and service. It was established in 2004 and was listed on Nasdaq in 2007 (Stock Code: PWRD)
With the headquarter located in Beijing, Perfect World has its wholly-owned subsidiaries to operate its games independently in North America, Europe and Japan, and has successfully licensed its games to the leading game operators in a number of countries and regions in Asia, Latin America, Australia, New Zealand, Russia and other Russian-speaking areas. Perfect World has built a significant presence on the overseas market and has been exporting its games to over 100 countries and regions in the world, providing high-quality online entertainment service to global internet users worldwide.
- PWRpwrdrink.com
Brand for a new concept energy drink, to be developed.
- Prince William Realty, Inc.pwrealty.com
Welcome to Prince William Realty!!! We're a full service brokerage firm providing services for all your real estate needs in Northern Virginia. Our professional agents come from various backgrounds and expertise in residential and commercial real estate. Our agents are dedicated in providing YOU with all the information needed in order to make an informed decision to buy, sell or rent.
We strive to provide each and every client with the highest amount of respect and quality of service. We guarantee that our level of experience, service and expertise is unparalleled by other companies. If you're looking for a lifelong relationship, contact us today! You won't be disappointed!
- Power Forward Sports Grouppwrfwd.co
Power Forward Sports Group is a consultancy specializing in player advocacy and sports marketing. Combining advertising expertise, a leading voice in player advocacy and a lifetime of experience as an athlete, Power Forward Sports Group helps companies, athletes, universities and agencies successfully navigate the world of sports.
Player Advocacy:
-Athlete Empowerment
-Athlete Mobilization and Organization
-Professional Development and Career Transition
Sports Marketing:
-Strategy
-Business Navigation
-Events
-Media
- PWR Mission Indústria Mecânica SApwrmission.com.br
A PWR Mission é uma empresa 100% brasileira, que atua há mais de 40 anos fabricando produtos e reparando equipamentos para os mercados de petróleo e gás, mineração, siderurgia e segmento energético em geral. Possuímos uma Unidade Industrial no Rio de Janeiro e Unidade de Serviços em Macaé, Catu e Alagoinhas (BA) os quais operam com instalação, monitoramento e manutenção de equipamentos de elevação artificial.
- PowerSys Sistemas Integradospwrsistemas.com.br
PowerSys Sistemas Integrados is a company based out of Brazil.
- Powerex Inc.pwrx.com
Powerex is your source for high power semiconductor solutions, including IGBTs, HVIGBTs, intelligent power modules, rectifiers, thyristors, custom power modules and assemblies.
- Pratt & Whitney Rzeszówpwrze.com
Founded in 1937, WSK 'PZL - Rzeszów' has become one of the leading players in the Central Europe aerospace industry. It was state owned for over 60 years and joined the United Technologies corporation family in 2002. WSK 'PZL - Rzeszów employs more than 4'100 workers in one facility located in the city of Rzeszów, on the Wisłok river bank. Company facilities house our head office, manufacturing, engineering, service center, customer support, finance and procurement.
WSK is involved in the following activities:
manufacturing
overhaul and post-sale services
special order services
design and research
- PWSpws.nl
PWS is a fast growing innovative company with the following departments:
Industieel Snijwerk: waterjet with total of 10 cutting heads, HD-plasma cutting, laser cutting.
Special Products: chemical instalations, biogas instalations, construction, engineering
Loading Technology: loading arms, folding stairs.
- Prince William Sound Aquaculture Corporationpwsac.com
Prince William Sound Aquaculture Corporation (PWSAC) is a non-profit corporation founded in 1974 by a local commercial fishermen's organization to optimize Alaska's wild salmon resources.
PWSAC produces hatchery-born, ocean-raised wild salmon for the commercial, sport, personal use and subsistence fisheries in the Prince William Sound and Copper River regions.
With headquarters in Cordova, Alaska, PWSAC operates four remote salmon hatcheries in Prince William Sound and one on the Copper River in Paxson. About 600 million salmon fry and smolt are produced for release into Pacific waters. The returning adults benefit all user groups.
PWSAC operations are financed through the sale of fish to processors and a salmon enhancement tax paid by commercial fishermen.
- Prader-Willi Syndrome Associationpwsausa.org
Prader-Willi Syndrome Association (USA) is an organization of families and professionals working together to raise awareness, offer support, provide education and advocacy, and promote and fund research to enhance the quality of life of those affected by Prader-Willi syndrome.
- PORT WASHINGTON STATE BANKpwsb.com
Offices in Saukville, Cedarburg, Belgium, Grafton, Fredonia, and Port Washington
- Peace Wapiti Public School Divisionpwsd76.ab.ca
Peace Wapiti Public School Division (PWSD) provides service to approximately 6,000 students in Kindergarten through Grade 12 in 33 schools, including eight Hutterite colony schools and an outreach and online school – Peace Academy of Virtual Education (PAVE) located in Spirit River. High school programs are operated in eight schools – Spirit River Regional Academy, Beaverlodge Regional High School, Eaglesham School, Ridgevalley School, Savanna School, Sexsmith Secondary School, Peace Wapiti Academy and PAVE. The Board also provides educational programming at a group home facility serving students in Northern Alberta.
The system provides schooling for students from Horse Lake First Nation and Kelly Lake Métis settlement. Excluding the colony schools, the smallest school has an enrolment of 52 students and the largest has more than 840 students. PAVE has an enrolment of approximately 70 full-time students, and more than 100 students registered in one or more high school courses. Effective Alternative Education programs are also in place with 15 students taking full-time programs in Grades 4-9, and more than 160 students taking one or more courses at the high school level.
In the smaller and more rural high schools, some reliance is placed on distance education programs to augment the basic in-school offerings. Specialty programs exist to meet local needs.
PWSD employs the full-time equivalent of 375 teachers and 600 non-teaching staff. The Transportation Department manages 104 bus routes. In addition, PWSD employs a considerable number of part-time and casual personnel, making it one of the largest employers in the Peace River Region.
Join the PWSD family. View our employment opportunities and apply online at http://www.pwsd76.ab.ca/employment.
- PWS Ltd (Professional Welding Services)pwsltd.co.uk
PWS Ltd has been in operation and serving various market sectors, predominantly aerospace, since 1984. We are a manufacturing company and offer a full service of precision fabrication, welding, Thermal and sound Insulation, CNC machining and assembly capabilities
We are NADCAP, ISO and AS 9100 Rev C approved and also hold many other customer and type approvals for a varied scope of capabilities and products.
We are a forward thinking business driven to achieve our customer needs by delivering reliability, quality and value for money products and solutions.
Our current markets include Aerospace, MRO, Marine, Military, Nuclear and Oil and Gas
- PW Stephens Environmental, Inc.pwstephensinc.com
- PWSWpwsw.pl
PWSW is a company based out of Poland.
- PWSZ Zamośćpwszzamosc.pl
PWSZ Zamość is a company based out of Poland.
- Printed Wiring Technologies Ltdpwtpcbs.com
Printed Wiring Technologies Ltd (PWT) is certified AS9001-RevC and is an expert in Fast Turnaround manufacturing of High Quality PCBs from Prototyping to Small/Medium volumes starting from 8 hours/3 days.
This specialization makes our prices surprisingly competitive as we are able to keep our cost base and therefore our prices, lower than manufacturers attempting to straddle the small/medium and large volume markets.
Specialities
Flexirigid, Flex, Rigid, Multilayer, High Density PCBs via our Fastflex service, controlled impedance and blind/buried vias. As well as traditional substrates we offer Rogers/Hybrid, Polyimide, PTFE and Metal Backed (IMS). We are also experienced with Carbon Ink applications.
We offer full Design for Manufacture (DFM) and New Product Introduction (NPI) services and are covering a broad range of industry sectors including Defence, Aerospace & Medical manufacturers.
- Paul West Used Carspwuc.com
Paul West Used Cars is a family owned business in Gainesville, FL. We understand that buying a used car can be scary; so many years ago we made a decision to only work with low mileage, clean, and pre-serviced vehicles. We do this so you can have peace of mind that you are leaving the lot with a quality vehicle.
Thank you for giving Paul West Used Cars (PWUC) an opportunity to earn your business. Our family will go the extra mile to make sure you are treated right and that you find the vehicle of your choosing. Please feel free to check our reviews to see what our current customers are saying! We also offer In House Buy Here Pay Here Financing if needed, so come be part of our Family!
Come Visit Us:
Address: 3320 N Main Street Gainesville, FL 32609
Web: www.pwuc.com
Email: [email protected]
Phone: 352-371-6440
Buy Here Pay Here Gainesville, FL
Buy Here Pay Here Ocala, FL
Buy Here Pay Here Lake City, FL
- PWV Insurance Brokers North (Pty) Ltdpwvnorth.co.za
PWV Insurance Brokers North offer fast professional, personal service for all your personal and commercial insurance needs. Our offering includes:
• Personal insurance
• Commercial insurance
• Marine insurance
• Liability insurance
• Court Bonds
• Guarantee insurance
- Paducah Waterpwwky.com