- Fidelity Commercial Bank Ltdfidelitybank.co.ke
Incorporated in 1988 as the African Finance Company, which then commenced operations as Fidelity Finance Limited in 1992, and eventually progressed its status to a full-fledged commercial bank in 1996. Actively been at the forefront of customer satisfaction through hi-tech banking services.
A fully fledged Commercial Bank operating in the Kenyan market for over 12 years present from the core to the coast with six fully equipped branches in the Kenyan cities of Nairobi, Diani, Malindi and Mombasa.
- Fidelity Bank / Oklahoma Fidelity Bankfidelitybank.com
Member FDIC | Equal Housing Lender | Equal Opportunity Employer
We understand that our customers need more than a bank - they need problem-solving solutions and partners. We stand ready to serve. Together we move Bravely Onward. ®
Learn more at fidelitybank.com and bravelyonward.com.
- Fidelity Bank Ghanafidelitybank.com.gh
After operating successfully as a Discount House for eight years, Fidelity Bank was granted universal banking license as the 22nd Bank by Bank of Ghana. Currently the 7th Largest Bank in Ghana in terms of Assets, owned by Ghanaian individuals and institutional investors including Africa Capital, SIC Life, SSNIT etc.. The vision of Fidelity Bank is to become a world-class financial institution that provides superior returns for all stakeholders; To our customers, the best place to bank; To our shareholders, the best place to invest; To our employees, the best place to work; To our regulators, the best place to benchmark. Fidelity Bank Ghana operates across 44 Branches and 67 ATMs across the country to provide world class financial services to Ghanaians.
- Fidelity Bank PLCfidelitybank.ng
Fidelity Bank Plc began operations in 1988 as Fidelity Union Merchant Bank Limited. By 1990, it had distinguished itself as the fastest growing merchant bank in the country. However, to leverage the emerging opportunities in the commercial and consumer end of financial services in Nigeria, in 1999, it converted to commercial banking and changed its name to Fidelity Bank Plc. It became a universal bank in February 2001, with a license to offer the entire spectrum of commercial, consumer, corporate and investment banking services.
- Fidelity Cooperative Bankfidelitybankonline.com
Fidelity Bank is one of the oldest and continually growing independent, local community banks in Central Massachusetts. We offer a full range of banking, investment, and insurance solutions across 10 full-service offices in Leominster (2), Worcester, Fitchburg, Gardner, Barre, Millbury, Shirley, Paxton, and Princeton.
At Fidelity Bank we believes that everyone –our clients, employees, and community members – deserve the opportunity to grow, improve, and realize their hopes and dreams. We do this through LifeDesign, our unique way of doing business and the promise they make to be caring, trusted friends and help our clients, employees, and community members get where they want to be. We strive every day to be the most caring bank in the community, because what's most important to us is not what's in a person's bank account, it's what's in their heart.
Since 1888, the bank has continued this commitment to the businesses, families, and individuals in the communities it serves; in turn, loyalty demonstrated by members of these cities and towns has allowed us to become one of the strongest financial institutions in the region. The FDIC and the Share Insurance Fund insure all deposits.
For further information, visit fidelitybankonline.com or call 1-800-581-5363.
- Fidelity Communicationsfidelitycommunications.com
A fearless approach to innovation, and our enduring commitment to enriching the lives of good people are what fuel Fidelity. Founded in 1940, Fidelity has established a long history of success and trust in the close-knit communities we serve. As a local Broadband Service provider, we have an in-depth understanding of the unique needs of our subscribers. We're committed to creating an incredible customer experience by delivering the reliable, up-to-date, and affordable service your home and business depend on.
- Fidelity Engineering Corpfidelityengineering.com
Fidelity Engineering Corporation is comprised of two operating divisions.
Our Mechanical Services Group is a Mid-Atlantic regional leader in HVAC systems design, installation and service. This division has locations in Sparks, Maryland, Beltsville, Maryland and Ashburn, Virginia.
Our Power Systems Group serves as the Mid-Atlantic distributor, installer and service company for Kohler Generators. This division has facilities in Sparks, Maryland, Alexandria, Virginia, Richmond, Virginia, Roanoke Virginia and Seaford Delaware.
- Fidelity Exploration and Production Companyfidelityepco.com
Fidelity Exploration & Production Company is involved in the acquisition, exploration, development and production of natural gas and oil resources. Fidelity's activities include the acquisition of producing properties and leaseholds with potential development opportunities, exploratory drilling, and the operation and development of natural gas and oil production properties. Fidelity shares revenues and expenses from the development of specified properties in proportion to its ownership interests.
Fidelity is headquartered in Denver and has operating offices in Glendive, Mont.; Sheridan, Wyo.; and, Houston, TX.
Fidelity is part of the WBI Holdings family of companies which are all indirect wholly owned subsidiaries of MDU Resources Group (NYSE: MDU). MDU Resources is a Fortune 500 company and a member of the S&P MidCap 400 index providing value-added natural resource products and related services and operates with three core lines of business: utility resources, energy, and construction materials. WBI Holdings comprises the energy business line for MDU Resources.
- Fidelity Funding Mortgage Corp.fidelityfundingmortgage.com
Fidelity Funding Mortgage Corp. is a direct lender offering a wide variety of mortgage products such as FHA, FHA 203k Rehab, VA, USDA, Conventional financing. Homepath, and HARP. With in house underwriting, funding and closing, we maintain control throughout the transaction.
- Fidelity Bank (Bahamas) Limitedfidelitygroup.com
Fidelity Bank (Bahamas)Limited is more than a bank; we are an institution committed to providing for all your personal and corporate financial needs.
With origins in the Bahamas since 1978 and in the Cayman
Islands since 1980, Fidelity is a financial services group offering
a comprehensive range of both domestic and international
financial products and services.
A knowledgeable and experienced management team utilizes a
local and global perspective for a well-rounded, objective and
cosmopolitan business approach. We offer our clients a full range
of banking services.
- Fidelity House Human Servicesfidelityhhs.org
The mission of Fidelity House Human Services is to support people with disabilities to live a rich and meaningful life.
We provide a wide variety of supportive services including information and referral, case management, behavior management support, parent training and support, workshops, ongoing therapeutic programs and recreational activities. Residential services include 20 community residence programs, adult foster care, shared living and support for individuals who live independently in apartments. Each of our more than 360 employees makes a unique and important contribution to the fulfillment of our mission.
- Fidelity Associates Insurance & Financial Servicesfidelityins.com
Established in 1906, Fidelity Associates has grown to become one of the oldest and largest independently owned insurance agencies in the Northwest.
Our size, history and professional reputation has gained us the respect of our many insurance carriers. This allows us to negotiate the best coverage and price for your specific needs.
When it comes to business or personal insurance services such as property and casualty, employee benefits, health and retirement planning, Fidelity Associates can make a difference. We take the time and effort to understand the needs of our customers, and work together with you to find insurance solutions.
Fidelity Associates' professional, caring team continues to provide ongoing exceptional service once the policy is issued.
It is our passion to make sure that the service we provide is above the expectations of our clients.
Experience the Fidelity Associates difference.
What an Insurance Broker should be!
- Fidelity Life Assurance Company Limitedfidelitylife.co.nz
Fidelity Life has been a leader in the New Zealand insurance industry for over 40 years.
In 1973 Fidelity Life began with a vision of a locally owned company where advisers and staff could "have their say" and provide direct input into the company and its products. Today, Fidelity Life is still proudly New Zealand made, owned and operated. We think that's important – after all, we're in the business of protecting the New Zealand way of life.
Our staff
We have a wide network of talented people who are dedicated to making Fidelity Life a friendly, progressive and trustworthy insurance company. Our staff contribute significantly to the success of the company and we encourage them to be the best that they can be at both a professional and personal level.
Our community
We continue to build on our reputation as a socially-responsible company and encourage our stakeholders to also help make a difference in our community and grow a more sustainable business.
Fidelity Life is a proud supporter of Leukaemia and Blood Cancer NZ, The Graeme Dingle Foundation, The Big Hoot and Parents Centre.
- Fidelity Life Associationfidelitylife.com
Founded in 1896, Fidelity Life is a company focused on helping everyday Americans gain some peace of mind by knowing they have life insurance protection.
In addition to the quality of our coverages alone, we strive to offer consumers a simple, informed and generally quick process with affordable options based on their needs, lifestyles and priorities.
For many families, life insurance can help:
* Maintain a family's standard of living
* Pay ongoing household debts
* Fund educational costs
* Pay for burial or other final expenses
* Leave the family a financial legacy
Hours: 8:00 am - 5:00 pm CT, Monday through Friday
Phone: 800.369.3990
E-mail: [email protected]
Written Correspondence:
Fidelity Life Association
P.O. Box 5030
Des Plaines, IL 60017
- Fidelity Mortgage, LLCfidelitymort.com
Fidelity Mortgage, LLC was established in early 2013. Though the company was established recently, Fidelity Mortgage has a staff with many years of experience. Ryan Engel, John Bonelli, Janet Broughton and Julian Burnett make up the core of Fidelity Mortgage. This staff brings over 45 years of strong lending experience to Fidelity Mortgage in mortgage loan origination.
Fidelity Mortgage, LLC is located at 436 Katherine Drive #300, Flowood, MS 39232.
A Mississippi Licensed Mortgage Company
NMLS 1039190
- Fidelity Paper & Supply Corp.fidelitypaper.com
Packaging Supplies Distributor with locations in New Jersey, Florida, Pennsylvania, Maine, Massachusetts. Specializing in Moving, Seafood and Pharmaceutical Industries. Also available to do custom orders. Give us a call to find out more about pricing and products.
- Fidelity Pension Managers Ltdfidelitypensionmanagers.com
- Fidelity Internationalfidelityrecruitment.com
Fidelity International provides world class investment solutions and retirement expertise to institutions, individuals and their advisers - to help our clients build better futures for themselves and generations to come. As a private company we think generationally and invest for the long term. Helping clients to save for retirement and other long term investing objectives has been at the core of our business for nearly 50 years.
We offer our own investment solutions and access to those of others, and deliver services relating to investing: For individual investors and their advisers we provide guidance to help them invest in a simple and cost effective way. For institutions including pension funds, banks and insurance companies we offer tailored investment solutions and full-service asset management outsourcing. And for employers we provide workplace pension administration services on top, or independently of investment management. We are responsible for total client assets of USD $397 billion / £306 billion / €348 billion from over 2.2 million clients across Asia Pacific, Europe, the Middle East, and South America.
All data as at 30 June 2017.
- Fidelity Security Groupfidelitysecurity.co.za
Fidelity Security Group is Southern Africa's largest integrated security solutions provider and the industry leader in protection innovation. Excellence in service delivery and implementation are fundamental to our impressive track record. By keeping abreast of the latest trends and technological developments globally, and continuously evolving and innovating, the Group remains a front-runner in the security solutions market.
Through a bouquet of services and related products the Group can tailor make a solution for any requirement. With the Group's exceptional leadership, the unwavering commitment of management and that of all its employees, the Group has enjoyed exceptional growth over the last five years.
The Group's Cash Solutions business continues to grow and has quickly become a serious competitor in the market, garnering a large number of high profile national contracts and bringing state of the art technology backed by Fidelity's hands on approach to the market.
With 56 years of experience, the company's strength lies in exceptional leadership, an unwavering commitment to excellent corporate governance, a comprehensive infrastructure and an aggressively proactive approach to staying at the forefront of the continually evolving security environment
Fidelity offers unmatched coverage, with a staff complement of over 36 000 in over 82 branches and depots across South Africa, Namibia, Botswana, Zimbabwe, Swaziland, and Zambia
The Fidelity Group's strategic and highly successful transformation and BEE initiatives have made it South Africa's largest Black Economic Owned Integrated Security Solution Provider
- Fidelityfidelityservices.com
- Fidelity Insurancefidelityshield.com
Fidelity Shield Insurance Company Limited is a leading general insurance provider offering a wide range of products to cater for individuals, private corporate companies, small and medium enterprises and governmental organisations and many more.
- Fidelity Technologies Corporationfidelitytech.com
Fidelity Technologies Corporation is a leading global supplier of quality services and products to Government and Department of Defense clientele in the areas of simulation and training, field support services, and military and aerospace manufacturing. Fidelity prides itself on having a customer-oriented approach to developing systems that are modular, customizable, and able to support future systems. As a defense contractor, Fidelity works to provide innovative solutions that address the ever changing needs of the warfighter. For more information, visit: www.fidelitytech.com.
- Fidelity Tech Solutionsfidelitytechsolutions.com
Simplification is our motto our purpose is to simplify the lives of people who use, deploy, and depend on IT Solutions. Simplification is at the heart of every solution we deploy. Our goal is to become a real "Value Added Partner", we will understand how technology affects your marketing, sales, brand, corporate identity, revenue and profits. Every Fidelity employee brings the following core values to our clients and partners: Loyalty, Integrity, Honesty & Faithfulness. It is the combination of these qualities and attributes that enhances our ability to build YOUR solution. At Fidelity Solutions, we exist to help simplify the lives of our clients, partners and employees. We do this by listening, understanding, and collaborating, delivering and measuring results.
- Fidel Technologiesfideltech.com
Fidel helps organizations & business owners to focus on their core business by helping them with Technology Implementation, Product Dev & Consulting in implementing Business Solutions.
Fidel offers services as follows:
IT Services
-Software Development / Testing / Maintenance (web /mobile applications)
-Infrastucture Support (server - network - application support // ServiceNow)
Localization
- Translation (Specialize in Japanese / ASEAN / Indian /South Asian / Mid-Eastern languages)
- Software Localization
- Testing (on various hardware terminals - for various language pairs)
Consulting
-Bilingual Staffing Services (Direct Hire/ Temp Staffing)
Fidel also offers following Business verticals:
-FinTech (www.fixsol.com) - FIX based Solutions (OMS, Test tool), Other Fintech Services (client onboarding, training, application development, testing)
-IoT-M2M (www.myrakshak.in) - Product development (Notification & tracking product /service for school kids - myrakshak.in) , Services (software development, deployment & maintenance)
With a team of 170+ members (Tokyo-India team), we offer the agility of a startup but maturity of a world-class company. We are ISO certified, quality & environment conscious & for last 10 years working closely with our customers- global Fortune 500 cos. & SMEs. Our employees, partners, clients love us!
- Fideltronik Polandfideltronik.com
For over 30 years we've been focusing on our customers' needs. By offering highest quality and flexibility we build long term relationship. This approach resulted in continuous growth that led us to become the biggest polish EMS company. Currently we operate in 6 international locations and have almost 2000 employees.
Everyday hundreds of our engineers work on customers products throughout product life cycle, from initial design, validation, testing, manufacturing, advanced logistics to aftermarket services. Our in-house Test & Tooling division, R&D department and EMC Laboratory enable us to provide complete solutions far beyond the sole EMS.
Having all the activities integrated in one ERP system we expand to new markets, continuously improve our processes and increase productivity.
Fideltronik — turn ideas into reality.
- Fidelus Technologiesfidelus.com
Fidelus Technologies based out of New York City, is a Professional and Managed Information Technology services company with a focus on customer success and business efficiency. With fifteen years of experience in the industry, our services include seamless networking, data center, wireless, security and Unified Communications (UCC) solutions for medium to enterprise-sized businesses.
We take pride in a culture of shared values that bring both our staff and clients together. Our team offers a unique customer service experience, built on delivering a high-level of customer satisfaction.
Fidelus offers a consultative, life cycle approach that includes requirements gathering, assessments, solution design, project management, engineering and adoption & evolution training services to support your organization with technology implementations and associated adoption efforts.
Additionally, our managed services team can act as a 24x7x365 extension of your existing IT department, providing proactive monitoring, troubleshooting, fault resolution, and system upgrades.
Contact us at www.fidelus.com for more information.
- Lifetime Solutionsfidelusadvisors.com
Lifetime Solutions is a company based out of 1506 Front St, Richlands, Virginia, United States.
- Fidely Groupfidelygroup.com.ar
Somos una agencia especializada en el desarrollo de campañas de fidelización de clientes que abarcan desde el planteamiento de la estrategia, infraestructura tecnológica, gestión de catálogos, alianzas comerciales, planes de comunicación y consultoría especializada.
Contamos con tecnología totalmente adaptable a la necesidad de cada proyecto en particular, permitiendo también la integración con diversos sistemas de gestión facilitando el desarrollo de las campañas.
Nuestros servicios permiten obtener resultados concretos y mensurables incrementando el valor de sus clientes, generando así aumentos en las ventas y un mejor posicionamiento de la marca.
Nuestro objetivo principal es ayudar a las empresas a establecer una relación más cercana con sus clientes con el fin de mejorar y fortalecer el vinculo.
- FIDENS ENGENHARIAfidens.com.br
Empresa que atua na area Civil em construção pesada, entrado no mercado de Óleo e Gas
- Fidentiis Capitalfidentiiscapital.com
Fidentiis Capital is an independent mid-market M&A advisory boutique created by Fidentiis and several investment banking professionals with experience in domestic and international markets. We offer corporate finance services related to mergers, acquisitions, divestments and fund raising, among others.
Fidentiis Capital is a member of Corporate Finance International (CFI), a group of 17 investment banking firms specialized in mid-market segment M&A transactions, with offices in 21 countries around the world, having completed over 500 M&A transactions since 2010.
- Fide Partnersfidepartners.com
Fide Partners has been recently created by experienced strategy and management consultants in the TMT sector.
Thanks to our expertise, commitment to deliver and capacity to add value to our clients we are experiencing exponential growth.
We are the Telecommunications, Media and Technology advisor that brings its global experience to make a lasting difference for our clients
We are a global company that works across developed and high-growth markets to serve as a gateway for ideas, experience and best practices.
Fide Partners advises all the players involved in the TMT sector to help them overcome their challenges and issues.
To see more about us visit our website www.fidepartners.com or contact us.
- FIDES Business Group '1989 - 2014'fides.be
Since 1989 Filip De Saeger and +25 colleagues are specialized in:
* Consulting & Improvement
* Quality Concept & Innovation
* Mergers & Acquisitions (MA)
* Business Development
* Project Management
* Change Management
* Selection & Recruitment
* Human Resources (HRM)
* Competence Management
* Mentorship & Coaching
* Training & Seminars (52)
* Easy-Learning & Books
* Solutions & Software (ICT)
* Webdevelopment & Design
* Marketing & Communication
* Fundraiser & Business Angel
- Fides Treasury Services AG - Reach Further. Connect Faster.fides.ch
Fides exists to help you reach further and connect faster.
Fides exists to simplify the resource-draining activities associated with bank communications and transaction aggregation. Our solutions enable corporate treasury and finance teams globally to expand their reach and communicate broadly.
We do this by leveraging our client and market knowledge to perpetually deliver economic solutions that are highly flexible, reliable, and simple to implement. With the power of Fides, our clients can streamline their multi-banking processes to achieve greater efficiency, intelligence, and accuracy in their communications.
The Fides model is client-driven, putting you at the center of all innovations and service experiences. Our promise is delivered through our unique connectivity and multi-banking expertise. We are continually learning and understanding the evolving bank languages and requirements so that you don't have to. By focusing on the real and individual needs of our clients, we can provide a scalable and sustainable single channel for transaction and communication aggregation, management, and execution. And, only Fides can provide the broadest geographic reach to banks across the globe.
The Fides way means you can conduct business your way.
- Fides Teknoloji ve Güvenlik Sistemlerifides.com.tr
Fides Teknoloji ve Güvenlik Sistemleri, Otomasyon, Elektronik Güvenlik ve Teknolojik Sistemler konularında faaliyet göstermeyi amaç edinerek 1994 yılında kurulmuştur. Gelişen teknolojiler ve büyüyen pazarla birlikte, Fides, ürün ve hizmet yelpazesini gün geçtikçe geliştirmiş, farklı ihtiyaçlara gereken en iyi çözümleri sunarak, müşterilerine "doğru sistemler"i sunma ilkesinden vazgeçmemiştir. Fides, Ankara Merkez ve İstanbul ofislerinde müşterilerine hizmet vermektedir.
Fides Teknoloji ve Güvenlik Sistemleri, kuruluşundan bu yana müşterileriyle güven ortamı içerisinde karşılıklı dayanışmaya dayalı ve müşteri memnuniyetini esas alan bir çerçevede çalışmalarını yürütmüştür. Teknolojinin tüm yeniliklerini, en kaliteli ürünlerle, tam vaktinde müşterilerimize aktarmak prensibimizden asla taviz vermedik. Çünkü Fides olarak müşterilerimiz ve yaptığımız işler, taviz veremeyeceğimiz en önemli prensiplerimizin başında gelmektedir.
- Fides Consulting S.r.l.fides.it
Fides nasce per creare una risposta a determinati bisogni e per cogliere determinate opportunità, pone la persona al centro delle proprie attività, con il compito di guidare e coordinare l'andamento dell'impresa, rendendo alto il senso di responsabilità delle risorse. Non vengono gestite le 'risorse umane' ma si cerca di gestire 'L'umanità delle risorse'; non vogliamo bravi esecutori ma collaboratori responasbili, cercando di nobilitare il rapporto impresa-collaboratore, e di valorizzare le loro capacità personali.
- Fides by Dümmen Orangefides.nl
Dümmen Orange is one of the world's largest breeding and propagation companies. Its headquarters are located in The Netherlands, with sales and production locations worldwide. The Fides entity is recognized for its Mums and Kalanchoes, with brands such as Calanday®, Calandiva® and Mystic Mums®.
- Fidescofidesco.de
FIDESCO is an international catholic relief Non-Governmental Organization that recruits, trains, and sends for one or two years to underserved areas of the world volunteers, who make their professional skills available to the needy through humanitarian and development projects. FIDESCO aims at the full development of all human beings without regard to religion, ethnicity, or culture differences.
- Fashion Interiorsfidesign.net
Fashion Interiors is a Design company located in 2108 10th St E, Glencoe, Minnesota, United States.
- Fides Corporate Services Limitedfidesmalta.com
Fides Corporate Services is a boutique firm uniquely qualified and positioned to provide creative, innovative and practical solutions specifically by focusing on Maltese corporate and tax planning, trusts & estate planning, financial services, shipping & aviation, igaming and all the required back office support your business may require in Malta.
Based in Valletta the capital city of Malta, FIDES provides a full range of specialised services to help you set up your business in Malta and to better comprehend the tax and regulatory benefits of using Malta.
- Fundacion I+D de software librefidesol.org
Fundación I+D del Software Libre, Fidesol, es una entidad sin ánimo de lucro y un Centro de Investigación y Desarrollo centrado en las Tecnologías de la Información y la Comunicación. Fidesol trabaja y se esfuerza para promover y fomentar la investigación, el desarrollo y la difusión de herramientas y servicios basados en estándares y tecnologías abiertos.
Así mismo, por el carácter de innovación continua de su actividad, es de vital importancia para ella la realización de acciones de vigilancia, prospectiva y transferencia tecnológica, así como de acciones de formación, difusión y colaboración con otras entidades públicas y privadas, tanto del ámbito nacional como internacional.
- Fidessafidessa.com
About Fidessa group
Exceptional trading, investment and information solutions for the world's financial community.
New technology, new regulation, new challenges: making money in today's financial markets is all about staying ahead of the curve. Having the capability to spot new trends and act fast turns change into opportunity. That's why 85% of the world's premier financial institutions trust Fidessa to provide them with their multi-asset trading and investment infrastructure, their market data and analysis, and their decision making and workflow technology.
It's also why $20 trillion worth of transactions flow across our global network each year. Because we're the market leader, we can also offer unique access to the world's largest and most valuable trading community of buy-side and sell-side professionals, from global institutions and investment banks to boutique brokers and niche hedge funds.
Fidessa is a global business with scale, resilience, ambition and expertise. We've been listed on the London Stock Exchange since 1997 and we're recognised as the thought leader in our space. We set the benchmark with our unrivalled set of mission-critical products and services and, uniquely, serve both the buy-side and sell-side communities. Ongoing investment in our leading-edge, integrated solutions ensures Fidessa remains the industry's number one choice.
www.fidessa.com
Follow us on www.twitter.com/fidessa
- Fides Spafidesspa.com
Fides S.p.A. è un intermediario finanziario, costituito nel 1947, che svolge attività di concessione di finanziamenti ai dipendenti pubblici e privati contro cessione del quinto dello stipendio o della pensione e delegazione di pagamento, ai sensi del D.P.R. 180/50 e del relativo Regolamento 895/50.
Nel 2007 entra a far parte del Gruppo Banco Desio, che gli conferisce una nuova veste e la rende destinataria di progetti di sviluppo.
Attualmente Banco di Desio e della Brianza S.p.A. detiene il 100% della partecipazione azionaria.
- Fides S.p.A.fidesspa.eu
Dal 1995 Fides opera nel mondo dei servizi per la tutela del credito.
Grazie al lavoro svolto in questi anni, può annoverare tra i suoi clienti molte tra le più importanti aziende operanti nel settore finanziario e bancario, nel mondo commerciale e delle utilities.
- Fides Taxateursfidestaxateurs.nl
Taxeren (taxeerde, heeft getaxeerd) (Fr.), (overg.) 1. de waarde van iets begroten, ramen, schatten. (Bron: Van Dale)
Onroerende zaken worden bij aan- en verkoop getaxeerd. Niet alleen omdat de financier verzekerd wil zijn van een correcte waarde van het onderhavige, maar vooral ook om de opdrachtgever zo snel en adequaat mogelijk te voorzien van een op maat gesneden financiering.
Fides (Lat.), (v) trouw
Om die taxatie betrouwbaar, vakkundig en snel te laten uitvoeren is een samenwerking met Fides Taxateurs® een logische keuze.
Fides Taxateurs® vertegenwoordigt een Nederlands netwerk van beëdigde en gecertificeerde taxateurs, die volledig op de hoogte zijn van de markt in hun specifieke werkgebied.
Fides Taxateurs® levert niet alleen een hoge kwaliteit van de taxateur, maar ook een taxatierapport dat aan alle eisen voldoet. Door onze samenwerking met het NWWI, iValidatie en TaxateursUnie, geven wij de garantie dat onze rapporten worden geaccepteerd door de door u gewenste geldverstrekker of verzekeraar.
Ook voor waardeverklaringen, herbouwwaardetaxaties en bouwtechnische keuringen kunt u bij ons terecht.
Voor meer informatie of een vrijblijvende offerte kunt u telefonisch of via e-mail contact opnemen met ons kantoor.
- Fideuram Investimenti SGRfideuramsgr.it
Società specializzata nello sviluppo e nella gestione di prodotti finanziari. Professionisti altamente qualificati dedicati all'analisi dei mercati, alla gestione dei prodotti ed alla consulenza in materia di investimenti con un unico obiettivo: offrire un servizio completo e prodotti all'avanguardia.
- FIDEXPERT SAfidexpert.ch
FIDEXPERT SA is an Accounting company located in 26 Rue du Coll??ge, Montreux, Vaud, Switzerland.
- FIDH - International Federation for Human Rightsfidh.org
FIDH is an international movement bringing together 178 human rights organizations in over 120 countries.
Since 1922, FIDH has been fighting against all forms of injustice, intolerance, and discrimination. FIDH acts and campaigns to protect victims of human rights' violations, to prosecute the perpetrators, and to prevent future violations.
- FIDIfidi.es
Foro de Ingenieros en Diseño Industrial.
Somos una organización joven, con 3 años de edad dedicada a la divulgación académica y el desarrollo cientifico del diseño. Contamos con ingenieros y estudiantes de ingenieria para poder seguir tegiendo la red industrial que necesita el diseño y así poder ayudar a las empresas a dar ese valor añadido a sus productos.
- FIDI Global Alliancefidi.org
The FIDI Global Alliance is the largest umbrella organisation of international removals and relocation companies.
We represent over 600 international removal & relocation companies, spanning 100 countries in 5 continents. All our members have been certified according to the FAIM (FIDI Accredited International Mover) quality standard, the only quality certification programme dedicated exclusively to the international moving industry.
- FIDI - Fundação Instituto de Pesquisa e Estudo de Diagnóstico por Imagemfidi.org.br
A Fundação Instituto de Diagnóstico por Imagem (FIDI) atua há 14 anos na saúde pública de São Paulo. Mantém convênio para operar a área de diagnóstico por imagem de diversos hospitais das Secretarias de Saúde do Estado e Município de São Paulo, prefeituras próximas à capital (São Caetano do Sul e Diadema), além dos Estados de Goiás e da Bahia.
Possui cerca de 2 mil funcionários e 500 médicos especialistas, que atendem em mais de 70 unidades de saúde realizando mais de 4 milhões de exames por ano, sendo o maior provedor de exames de diagnósticos por imagem do país para a área pública.
- Fidia Spafidia.com
Progettazione e produzione di sistemi di fresatura a 5 assi continui e di controlli numerici sofisticati per la fresatura ad alta velocità delle superfici sculturate.
Fornitura chiavi in mano di sistemi di lavorazione efficente per l'industria manifatturiera Aeronautica.
- Fidia Farmaceutici SpAfidiapharma.it
Privately held, fully integrated Italian pharmaceutical company, with R&D, manufacturing, marketing, and sales capabilities.
Fidia Farmaceutici S.p.A founded in Bologna (Italy) in 1946 and relocated to Abano Terme (Italy) in 1959, is part of the P & R Group since 1999, ranked among the top ten national chemical groups.
The Group counts more than 1.800 employees, distributed between the chemical and pharmaceutical market segments
Fidia Farmaceutici S.p.A. and its associated companies operate worldwide with the aim of developing and marketing innovative healthcare products (medicinal products, medical devices, and dietary supplements), primarily based on proprietary hyaluronic acid (HA) and its derivatives.
More than fifty years of research into this molecule have placed Fidia at the forefront in the production of both natural and functionalized hyaluronic acid, utilizing proprietary and validated extraction and biotech processes.
Fidia is continually working to identify new opportunities and holds an extensive patent portfolio worldwide covering HA molecular weight fractions, industrial processes, pharmaceutical formulation/composition, derivatives, and uses.
Fidia sells its products worldwide, through a comprehensive network of international partners, and has established a direct presence in attractive markets - including USA, Germany, Spain, Kazakhstan, Russia, Middle East, Czech Republic and Slovakia - with local business and liaison offices.
- FIDIA Srlfidiaweb.net
Da oltre 25 anni operiamo nei mercati della formazione e della consulenza in tutto il territorio nazionale con sedi a Trento, Milano e Catania.
La sede di Trento (legale ed operativa)
• è accreditata presso la Provincia Autonoma di Trento per l'attuazione degli interventi formativi cofinanziati dal Fondo Sociale Europeo (formazione superiore e continua)
• è Mec Center accreditato Certiport, ufficialmente riconosciuto da Microsoft e Adobe ad erogare contenuti formativi sui suoi prodotti e rilasciare certificazioni
La sede di Milano (amministrativa ed operativa)
• è accreditata in Regione Lombardia per l'educazione continua in medicina (ECM) ed il riconoscimento dei crediti
• è nell'elenco dei Centri di ricerca e trasferimento tecnologico accreditati dalla Regione Lombardia in QuESTIO (Quality Evaluation in Science and Technology for Innovation Opportunity)
• attua piani formativi su tutto il territorio nazionale nell'ambito dei principali fondi interprofessionali ed è accreditata nei fondi "Fon.ter" e "Fondoprofessioni"
La sede di Catania (operativa)
• è accreditata presso la Regione Sicilia per l'attuazione degli interventi formativi cofinanziati dal Fondo Sociale Europeo (formazione post-obbligo formativo).
- Fidiliofidilio.com
Fidilio is the first and the most popular directory of restaurants, coffeeshops and promenade venues in Tehran and other cities in Iran; it has a large community of food-enthusiast people who contribute to Fidilio. Fidilio has been always a successful source of various discounts for its users.
- Fiditaliafiditalia.it
Fiditalia appartiene a Société Générale, tra i maggiori gruppi finanziari nella zona Euro.
E' una delle principali società italiane di credito al consumo, settore in cui opera da trentacinque anni e nel quale si è affermata come società "multiprodotto" e "multicanale".
Alle famiglie, offre soluzioni finanziarie personalizzate e concede credito attraverso diverse linee prodotto:
- prestiti finalizzati all'acquisto di beni e servizi
- prestiti personali
- cessione del quinto dello stipendio o della pensione
- carte di credito
- leasing.
Ai propri partner commerciali (punti vendita ,grande distribuzione, concessionari, banche e assicurazioni) l'azienda fornisce:
- soluzioni di finanziamento per consentire loro di soddisfare le esigenze di una clientela sempre più
esigente e diversificata
- esperienza, mezzi e tecnologia, per un supporto commerciale costante e qualificato.
Fiditalia occupa una posizione di rilievo in tutte le categorie merceologiche ed è presente su tutto il territorio nazionale con una rete commerciale costituita da 12 Aree Territoriali e 120 Agenzie.
Conta circa 1 milione di clienti attivi.
- FIDIUS™fidius.co.za
FIDIUS™ is a fee based financial planning and advisory co, assisting clients with planning to optimise their wealth creation, preservation and utilisation goals.
- fidlfidl.ch
fidl is a company based out of Switzerland.
- Fashion Institute of Design & Merchandisingfidm.com
Creative careers begin here.
For over 40 years, FIDM has been educating students for professional careers in Fashion, Entertainment, and Digital Media, offering Bachelor's and Associate's Degrees in 26 creative majors.
Our talented faculty, dedicated staff, and renowned industry partners work together to create an academically rigorous, career-focused curriculum. Each of our four campuses is strategically located in California's entertainment, fashion, and action sports industry and business hubs in Los Angeles, Orange County, San Diego and San Francisco.
FIDM's Career Center team has exceptional connections within our industries and offers one-on-one targeted career planning and placement services. Last year 10,000 companies posted over 21,000 jobs on our online job board, open only to our students and alumni.
FIDM does not discriminate on the basis of race, color, national origin, sex, disability, or age in its programs and activities, employment, and admission.
- Fido-Biznesfido.uz
Fido-Biznes is a company based out of Uzbekistan.
- FIDO Alliancefidoalliance.org
The FIDO (Fast IDentity Online) Alliance plans to change the nature of authentication by developing specifications that define an open, scalable, interoperable set of mechanisms that supplant reliance on passwords to securely authenticate users of online services. This new standard for security devices and browser plugins will allow any website or cloud application to interface with a broad variety of existing and future FIDO-enabled devices that the user has for online security.
- FIDOBANKfidobank.ua
ПУАТ 'ФІДОБАНК' (www.fidobank.ua). В 2012 році група компаній, власником яких є Олександр Адаріч, придбала СЕБ Банк (з 1991 до 2004 – банк «Ажіо»), після чого банк змінив назву на ПУАТ «ФІДОБАНК». В квітні 2013 року цією ж групою компаній була закрита угода з купівлі Ерсте Банку – дочірнього банку Erste Group Bank AG, який було перейменовано на ФКБ БАНК. В жовтні 2013 року ФКБ БАНК було приєднано до ФІДОБАНКу на правах філії. А в січні 2014 року банки перейшли на єдиний МФО. Об'єднаний банк увійшов до II групи банків за обсягом активів, відповідно до класифікації НБУ. Банку вдалося піднятися на 7-е місце в групі великий банків та 22-е місце в загальному рейтингу банків з активами більше 15 млрд грн на кінець 2013 року.
ФІДОБАНК надає весь спектр банківських послуг для фізичних і юридичних осіб. До мережі банку належить 150 відділень, які обслуговують 1389 корпоративних клієнтів, понад 350 000 роздрібних клієнтів і близько 26 000 СМБ.
ФІДОБАНК володіє банківською ліцензією НБУ № 4 від 13.07.2012 року і Генеральною ліцензією НБУ №4-3 від 28.10.2013 року. Є членом Незалежної асоціації банків України, Української міжбанківської асоціації членів платіжних систем «ЄМА», Фонду гарантування вкладів фізичних осіб (свідоцтво №066 від 2 вересня 1999 р.), міжнародних платіжних систем MasterCard International і VISA International.
Контактна інформація:
тел.: 0 800 30 76 76 (безкоштовно зі стаціонарних та мобільних телефонів в Україні)
ел. адреса: [email protected]
cайт: http://fidobank.ua/
Ми в соціальних мережах:
Facebook https://www.facebook.com/fidobank.ua
Вконтакте http://vk.com/fidobankua
Twitter @FidobankUa
WordPress Blog http://fidobank.wordpress.com/
- fido fido, LLCfidofido.com
- Fido Mobilefidomobile.ca
Fido has revolutionized the wireless industry in Canada with a unique approach to pricing, a money-back satisfaction guarantee and more. Today, we continue to move ahead with new voice and data technologies as well as the latest in wireless Internet services to keep you connected to what matters most in your life.
- FIDSERVE SAfidserve.com
Swiss Independant Trust Company
- Fidson Healthcare Plcfidson.com
Fidson Healthcare Plc, World-Class Healthcare Company, World-Class Healthcare Solutions,Leading Pharmaceutical Company in Nigeria, Top Pharmaceutical company in Nigeria, Top 10 leading Pharmaceutical Company in Nigeria, Top 5 Pharmaceutical Company in Nigeria.
- FID GmbHfidtech.ru
FID GmbH is a company based out of Russia.
- FinWell Group LLCfidtp.com
In a nutshell, Life in a Box client appreciation gi
fts provide value:
For Your Client
- A unique gift that is actually useful for many y
ears.
For Your Business
- Provides an ongoing brand building campaign.
There are 6 key points that I believe are important
to you regarding this program:
1.
Distinctive -
The gift is highly unique, has a $300+ perceived v
alue and clients truly
appreciate it – for less than $40.
2.
Repeat Visibility
– Your average client will see your name and inform
ation 28 times per
year in a non-selling, value added medium.
3.
Generates Sales -
The program is actually a profit center – not a co
st center because it
generates referral sales and repeat sales. If only
1 in 100 of your clients gives you a
referral in the next 12 months the program is profi
table.
4.
Tax Benefits -
The program is 100% tax deductible since it is a m
arketing expense.
5.
Inclusive -
You can add past clients and SOI to the program fo
r no additional fee (up to
1,000 contacts).
6.
Available -
The product is readily available, simple to order
and simple to store. You do
not have to place bulk orders.
I will follow up after you review the attachments t
o see if you would like a sample.
Thank you for the opportunity to introduce Life in
a Box, I sincerely appreciate your time.
- CFG Cabinet Comptable & Fiscal Sàrlfidu-cfg.ch
Notre cabinet est à même de vous aider dans tous les domaines :
- comptables & fiscaux (impôts, TVA, etc.)
- salaires & prévoyance
- administratifs & organisation
- exécution testamentaire, lors de décès, successions, gestion d'hoiries : soutien administratif, fiscal, remise de locaux, conseils, etc
- gestion de fortune: surveillance de toute participation financière et/ou de l'évolution patrimoniale, mise en contact avec des gestionnaires bien établis et reconnus, d'une manière générale de toutes opérations et fonctions entrant dans la sphère d'activités de sociétés fiduciaires
-soutien et conseils personnalisés
- immobilier (achats, ventes, gestion, PPE, obtention de crédits)
- Fiduciaria Bogota SAfidubogota.com
With an extensive background in the management of trust services and mutual funds, and a great dynamism and innovation in delivering them, Fiduciaria Bogotá SA, a subsidiary of Banco de Bogota, belongs to the leading financial and banking conglomerate in Colombia, Grupo Aval.
It was established on September 1991 with the object of operating in activities such as Investment Trust, Trust Administration, Trust Origination, trusteeship, money management, and in general, all authorized operations for trusts.
It is currently the second largest trust company in Colombia in terms or assets under management with well over US$ 8 billion in managed funds, and the leading trust company in the market in terms of income.
For continuous operation, the Fiduciaria counts with the financial backing, and the technical and financial infrastructure of the Bank.
- Fiducia Management Consultantsfiducia-china.com
Fiducia is a professional services provider focused on Greater China. For 35 years, our team of more than 120 consultants and specialists in 4 offices in China has provided integrated support in accounting, corporate and trade services, consulting and recruiting, to deliver practical solutions for international mid-market clients sourcing from, selling to, or investing in China.
- Fiducia S.A.fiducia-luxembourg.lu
Fiducia S.A. is a company based out of Luxembourg.
- Fiducia & GAD IT AGfiduciagad.de
Fiducia & GAD IT AG is the IT service provider of the Genossenschaftliche FinanzGruppe Volksbanken Raif-feisenbanken, Germany's financial group of cooperative banks. The company based in Karlsruhe and Münster with further offices in Munich, Frankfurt and Berlin employs currently more than 5,600 staff, generating an annual turnover of around 1.3 billion Euros.
Among Fiducia & GAD's customers are all of the approximately 1,000 Volksbanks and Raiffeisenbanks in Germany, further companies from the Genossenschaftliche FinanzGruppe, as well as numerous private banks and companies from other business segments, such as the German automobile club (ADAC).
Fiducia & GAD provides IT services for 167,000 banking work stations, administers roughly million banking accounts and ensures comfortable cash supply by providing 36,000 ATMs and self-service terminals all across Germany. In its four high-security data processing centres Fiducia & GAD cur-rently operates two core banking applications 'agree' and 'bank21', both of which will be gradually replaced in the course of the next years by the comprehensive new application 'agree21'.
- Fiducia Groupfiduciagroup.co.uk
A financial advice group built on the simple principal that clients prefer to build long term relationships over financial matters with the same person.
Built on personal recommendation, Fiducia has established itself as one of the UK's most refreshing financial advice outlets.
Fiducia Group of companies is made up of Commercial Solutions, Comprehensive Financial Planning, Corporate Finance and Mortgage Solutions, each serving clients in need of business finance, insurance, mortgages (inc. commercial), mortgages (inc. remortgages), protection and more.
- Fiduciaire Associés SPRLfiduciaireassocies.be
Nous assurons un service spécialisé à nos clients tout au long de notre mission.
Nos prestations consistent à accompagner nos clients lors du démarrage de l'activité, tenir la comptabilité, prendre en charge la fiscalité, donner des conseils en matière d'expertise comptable et fiscale.
En concertation avec les clients, nous proposons des services personnalisés et adaptés à leurs besoins spécifiques.
Afin de répondre à ces objectifs, notre fiduciaire s'est diversifiée pour proposer l'éventail de services suivants :
- Mission comptable
- Mission fiscale
- Mission d'aide à la création d'entreprise
- Mission d'audit
- Relations avec les organismes bancaires
- Missions spéciales
- Mission informatique
Nos collaborateurs peuvent aussi tenir la comptabilité en vos locaux et intervenir sur votre logiciel comptable.
- Fiducialfiducial.fr
Fiducial is a major international provider of professional services to small businesses. As a true partner to entrepreneurs and business owners, Fiducial allows them to focus on what they do best: serve their clients.
Founded in 1970 in France and privately held, Fiducial operates globally from subsidiaries in Europe and in the USA, and through Fiducial International, its worldwide network.
Fiducial entered the US market in 1999 and expanded operations nationwide through company-owned and franchised offices. The company's success is the result of a clear focus on professional services for small businesses and individuals, providing them with a one stop shopping experience through 5 major business lines: Business Counseling, Bookkeeping, Payroll, Tax and Financial Management.
The company is currently initiating a restructuring process to support its ambitious growth objectives: the expansion of the national network through an active strategy of acquisitions, the development of new products/services, and a strengthened management team.
For further information, please visit http//www.fiducial.com
- FIDUCIAL EXPERTISEfiducial.net
World leader in the field of multidisciplinary services for smaller businesses. ppppppppppppppppppppppppppppppppppppp
- FIDUCIAL Cloudfiducialcloud.fr
FIDUCIAL Cloud, Opérateur et Fournisseur de services Cloud depuis plus de 10 ans, met à votre disposition une offre globale de solutions et prestations, garantissant la disponibilité permanente de votre Système d'Information et de vos applications métiers.
Au travers d'offres de liens et de solutions Cloud, nous permettons aux entreprises de se recentrer sur leur cœur de métier, tout en bénéficiant d'un service adapté à vos besoins.
Que ce soit pour des projets de messagerie hébergée, de Sauvegarde Externalisée, de PRA, de Téléphonie sur IP, d'Accès Internet (XDSL ou et Fibre Optique), de Cloud Privé, de Cloud Public, de IaaS, de Housing, de Sécurité ou bien de services Managés 24/7/365, nous avons forcément une réponse précise à vous apporter.
Depuis notre Centre de Services managés certifié ISO 27 001 et au travers de nos 6 Data Centers en France, FIDUCIAL Cloud vous apporte une expertise globale autour des technologies du Cloud.
Qu'il s'agisse de fourniture de ressources Cloud Public (IaaS, messagerie et services collaboratifs, support de PRI), d'hébergement et d'Infrastructures Cloud privées, ou de services opérateur (interconnexion de sites, accès Internet, sécurité, voix sur IP), FIDUCIAL Cloud assure des services professionnels à Valeur Ajouté.
FIDUCIAL Cloud c'est aujourd'hui plus de 300 Clients, pour lesquels nous opérons plus de 600 liens et gérons plus de 2 000 serveurs virtuels avec des Consultants certifiés sur les technologies du Cloud.
Confier son Système d'Information à FIDUCIAL Cloud, c'est bénéficier de la proximité, du savoir-faire et de la réactivité d'un partenaire en pleine expansion, appartenant à un groupe stable et reconnu depuis plus 40 ans pour son offre globale de services aux entreprises !
- Fiduciaria Bancolombia S.A.fiduciariabancolombia.com.co
Empresa prestadora de Servicios Fiduciarios.
- FiduciarySoft Systemsfiduciarysoft.com
FiduciarySoft Systems is a Technology and Service provider specialized in designing, developing and integrating comprehensive IT solutions for the financial, investment, oil, real estate, and construction industries.
Mission
- To be the choice for providing information solutions and services
- To become a major contributor to the Islamic financial industry in terms of facilitating the standardization of operations, techniques, instruments, contracts, structures, policies and procedures by enabling organizations to respond to the business and information challenges based on best practices rather than improvised practices.
Awards
Oracle Gold Business Partner
SugarCRM Bronze Partner
Products
The Solutions includes the following Business Areas:
- Direct Investment - Business Development.
- Assets Management – Portfolios & Funds.
- Treasury.
- Corporate & Consumer Finance.
- Real Estate Financing.
- Real Estate Management.
- Real Estate Development.
- Project & Construction Management.
- Settlements - Operations.
- Human Resource Management.
- Client Management System.
- Compliance & AML management.
- Fidufrance Avocatsfidufrance.com
Fidufrance Avocats is a law practice company based out of 10 avenue de Messine,, Paris, Île-de-France, France.
- FID Uitzendbureaufiduitzend.nl
FID is een allround uitzendbureau en zendt mensen uit in de meest uiteenlopende functies en beroepen. Mensen met ruime ervaring, maar ook enthousiaste nieuwkomers op de arbeidsmarkt. FID is een no-nonsense uitzendbureau met kantoren in Emmen, Groningen, Amersfoort, Hengelo, Hattem en Oosterhout.
- FIDUCIAIRE DE LORRAINEfidulorraine.fr
Diriger une entreprise ou un commerce, exercer une profession libérale, présider une association, animer un comité d'entreprise : ces responsabilités exigent des qualités d'entrepreneur et de gestionnaire.
En vous appuyant sur les équipes de la Fiduciaire de Lorraine, vous optimisez vos chances de succès, vous sécurisez votre gestion et vous limitez vos risques.
- FIDUPARfidupar.eu
FIDUPAR was incorporated in 2000 by the contribution in kind of the financial engeneering department of Paribas Luxembourg.
The company's main purpose is to pursue activities of a professional of the financial sector, as amended,
as a, investments firm in the capacity of a commissioner,
as a registrar agent,
as domiciliation agent for companies, including incorporation and management of companies.
The company may act as trustee under the terms provided by the law of 27 July 2003 on fiduciary contracts.
It may also provide services regarding the survey, the creation, the promoting of business, economic and investments projects, the administration, the incorporation, the transformation, the reorganization of companies as well as corporate and financial engineering structures related to its purpose.
- Fiduprevisora S.A.fiduprevisora.com.co
Fiduprevisora S.A. es una Sociedad de Economía Mixta de carácter indirecto y del orden nacional, sometida al régimen de Empresa Industrial y Comercial del Estado, vinculada al Ministerio de Hacienda y Crédito Público, vigilada por la Superintendencia Financiera de Colombia y con control fiscal reglamentado por la Contraloría General de la República.
Creamos y manejamos soluciones fiduciarias con altos niveles de calidad, eficiencia y respeto por el medio ambiente para la ejecución de políticas gubernamentales y la administración de recursos y proyectos de nuestros clientes del sector público y privado. Somos líderes en el sector fiduciario creciendo de manera sostenible y creando valor agregado a los accionistas, clientes, colaboradores y la comunidad en general.
"Generamos confianza al País, volviendo simple lo complejo, a través de soluciones integrales en la gestión eficiente de recursos, con impacto social y desarrollo sostenible'
- Fidus Management BVfidusmanagement.nl
Fidus Management verzorgt interim management en consultancy bij overheidsorganisaties. Door de brede ervaring binnen gemeenten hebben wij veel kennis van ambtelijk organisaties en van het 'politieke bedrijf'. Fidus bouwt aan bruggen tussen mensen binnen en buiten de organisatie. Samen doelen bereiken staat hierbij voorop. Bij organisaties in ontwikkeling is de (te genereren) bindende kracht en vertrouwen in het (interim-) management cruciaal. Ook bij het bouwen van bruggen tussen bedrijven en overheid kan Fidus een nuttige coachende en ondersteunende rol vervullen.
Fidus Management is ook actief op het gebied van internationale samenwerking tussen gemeenten. Simon Jelsma werkt sinds 1995 in Roemenië aan management, planologie en milieu. Cristina heeft met haar Roemeense achtergrond en universitaire opleiding filosofie veel kennis van de Roemeense cultuur en gemeentelijke werkwijzen. Met haar kennis van de Nederlandse, Roemeense, Engelse en Franse taal slaat ze bovendien ook taalkundige bruggen tussen deze EU landen.
Fidus Management BV verzorgde onder meer:
- Interim management op 5 verschillende afdelingen in gemeente Wieringermeer.
- Training voor het ambtelijk management van de Roemeense gemeente Medias.
- Analyse van de begroting van Medias.
- Projectleiding ontvangst Koningin Beatrix en haar familie (Koninginnedag 2008 in Makkum).
- Projectmanagement 2e fase Agriport A7 (ontwikkeling van 1000 ha nieuw glastuinbouwgebied).
- Invulling interim-hoofd afdeling Ruimtelijke Ontwikkeling gemeente Littenseradiel.
- Invulling interim-directeur van de Vereniging Stadswerk Nederland
- Projectleiding nieuwbouw rsg Wiringherlant (middelbare school voor ruim 1000 leerlingen).
- Persoonlijke coaching (project)managers binnen de overheid
- FIE - International Fencing Federationfie.ch
The International Fencing Federation (FIE) is recognized by the International Olympic Committee (IOC) as the world governing body of fencing. We are proud to be an Olympic sport since 1896 and to have 151 affiliated member federations all over the world. In 2013, the FIE celebrated its' 100th anniversary. The FIE establishes the rules to which international competitions must be organized and oversees their implementation.
Every year, the FIE organizes Senior, Junior, Cadet and Veteran World Championships. It is among our aims to promote the development of fencing and nurture the practice of our sport throughout the world tighten the ties of friendship which unite fencers of all countries promote and develop the struggle against Doping ensure that the principle of non-discrimination on the grounds of race, sex, ethnicity, religion, political opinions, family status or other is respected.
- Federação das Indústrias do Estado da Bahia -FIEBfieb.org.br
O Sistema Federação das Indústrias do Estado da Bahia – Sistema FIEB, é uma entidade privada e que representa a indústria baiana, tendo como objetivos principais promover e apoiar ações que visam o crescimento, modernização e melhoria da competitividade industrial do Estado e que melhorem a qualidade de vida dos industriários e de seus dependentes.
É composto pelas instituições: Federação das Indústrias do Estado da Bahia – FIEB, Centro das Indústrias do Estado da Bahia – CIEB, Serviço Social da Indústria – SESI, Serviço Nacional de Aprendizagem Industrial – SENAI e o Instituto Euvaldo Lodi – IEL. As instituições atuam em conjunto e de forma integrada, prestando serviços nos campos de educação e qualificação profissional; saúde e lazer; informação especializada; e difusão tecnológica.
- FIEBEXfiebex.com
Fiebex is a boutique consultancy firm providing project management and strategy direction to companies wishing to enter or increase their exposure in the renewables and or conventional energy sector.
- Fiedler Groupfiedlergroup.com
Founded in 1957, Fiedler Group is widely considered the authority in innovative architectural, design, and engineering services.
Headquartered in Los Angeles, the firm provides an inclusive range of expertise to elite members of the Fortune Global 500 and independent franchisees throughout the United States.
Our core services include:
- Site Investigation Reports/feasibility studies,
- entitlement processing,
- design and engineering,
- permit acquisition,
- bidding and procurement assistance,
- construction support, and
- program management.
Still wondering why so many companies prefer Fiedler Group over the competition? Visit www.fiedlergroup.com to learn more!
- Fiedler Insurancefiedlerinsurance.com
Fiedler Insurance is an Insurance company located in 141 N Ludington St, Columbus, Wisconsin, United States.
- Fiege Logistikfiege.com
Our product is efficiency. As a leading contract logistics provider, we create complex solutions with our motivated employees for our partners' value chains: customised, innovative, and sustainable. Our qualified personnel make us an expert in planning, operating and managing integrated supply chain solutions for our customers. 12,338 employees work in a family-like environment at 178 locations in 15 European and Asian countries, for you.
Career: http://bit.ly/FiegeKarriere
Jobs: http://bit.ly/FiegeStellenmarkt
As a tradition-conscious family business managed by its fifth generation, we continually reinvent ourselves, to remain state of the art in times of digitisation and automation. Modern thinking drives us.
Industry expert for our focal markets
http://www.fiege.com/de/industries/
We are a specialist in our core sectors. Years of industry expertise and the latest technical know-how are especially important to us as your competent partner. This is why we have been focusing purposely on our core industries all these years - because we want to be experts in everything that we do.
Whether fast-moving consumer goods, a frequently changing product assortment or sophisticated, highly-sensitive products - the specific demands on logistics are high and diverse. Your product determines the type of storage, the distribution and the handling. We explore the best supply chain solution for you and help you to redirect your focus on your core competences, to save time and costs.
- fiegel.iofiegel.io
fiegel.io is an Internet company located in Nordring 56, Bochum, North Rhine-Westphalia, Germany.
- Field & Conceptfield-concept.com
Field & Concept was born 28 year ago and is today an established value in the field marketing sector.
Our core business lies in optimizing the brand awareness, visibility and sales of our clients.
Through strategic and conceptual advice we enforce sales force, brand activation, merchandising and logistics.
We train and coach tailor-made and passionate teams with one clear mission: speak to the heart of the consumer.
- Field Studies Councilfield-studies-council.org
Field Studies Council (FSC) believes the more we know about and take inspiration from the world around us the more we can appreciate its needs and protect its diversity and beauty for future generations.
We are the only environmental education charity dedicated to helping people of all ages to experience the environment at first hand; to discover, explore and be inspired by the natural world.
Each year over 140,000 people visit our Centres either as a child on a family holiday, a young person on a school fieldtrip, an adult on a leisure learning course or a teacher on a professional development course.
- FIELD.IOfield.io
FIELD creates expressive and dynamic artworks for digital platforms:
audio-visual installations, experiences for web and mobile, and shareable digital artefacts.
We explore Colour, Life, and Infinity through new technology and a research-led approach
– hi-tech experiences with a human touch.
- Field Africafieldafrica.com
a single contact point for market research in Africa
- Fieldair Holdings Ltdfieldair.co.nz
The Fieldair Group comprises:
Fieldair Engineering Ltd - Engineering for Aviation.
Founded in 1951 to service the agricultural top dressing industry the company grew to a fleet of 45 aircraft and has become one of New Zealands leading avaition engineering companies. The company carries NZCAA Part 145; 148 and 19F accreditation. Additionally all activities are run under an ISO9001 (BVQI) certification.
Air Freight NZ Ltd - an inhouse provider of domestic air freight and forming a strategic part of the air bridge between the North and South Islands of New Zealand. The company is NZCAA part 121 and 125 certified.
- Fieldale Farms Corporationfieldale.com
Founded in 1972, Fieldale Farms Corporation sells both conventional and antibiotic-free ("ABF") chicken products to retail and foodservice customers under several well-recognized brands, as well as private label. Fieldale has sold ABF chicken since1998 and continues to be a leader of quality ABF products.
During its fiscal year-ended September 27, 2014, Fieldale sold 830 million pounds of product.
- Field & Stream Shopsfieldandstreamshop.com
Field & Stream is a place where outdoor enthusiasts can connect with the traditions that have developed over generations. We offer the finest selection of merchandise from the most trusted outdoor brands and provide in-depth professional services for archery equipment, fishing gear, firearms and more.
Our Field & Stream specialty outdoor concept focuses on the core hunting, fishing and camping market, drawing on our decades of experience in this area, as well as our established relationships with key vendors, including Sitka, Beretta, Browning, Wilderness Systems and Yeti. In addition to offering authentic, high-quality products, our Field & Stream stores feature in-store specialty shops dedicated to archery, hunting and tackle, which offer outdoor enthusiasts a broad range of professional-grade equipment services, from arrow cutting to line spooling.
A division of DICK'S Sporting Goods INC, Field and Stream opened two stores in 2013, which proved to be our most successful store openings ever in terms of both sales and customer turnout. Our growth going forward will be aggressive. Come be part of a winning tradition!
- Xvision Software ASfieldap.com
Xvision Software develops an innovative, efficient, and cost saving SaaS SW platform for digital energy using modern web and cloud technologies. We are bringing data into plain sight through easy-to-understand and easy-to-use 2D/3D/VR visualization directly in your web browser.
- FieldArm Limitedfieldarm.com
FieldArm consists of 3 experienced agronomists (2 ex farmers) plus 4 support staff operating from 3 regional bases in England plus use of a preferential contractor in Scotland, with many years of field trials management experience in the Team.We are ORETO Certified in the UK with BASIS, FACTS and NPTC qualifications and work to GEP standard applying GLP practice.
FieldArm cover all aspects of field research from planning to final report, generating protocols and reports based on ARM9 tailored to the clients' needs and conducting the field trials to a high standard. We offer a personal service by excellent communication with the client on a one to one basis, with a strong emphasis on customer service to ensure that we hit the target and meet the deadlines.We work with most of the multinationals and have expertise in all arable crops and stored crops, vegetables, horticultural crops, non-crop, nursery, forestry, golf course, amenity turf and home and garden. We work with, and have good experience of, all types of agrochemical and horticultural products – herbicide, insecticide, fungicide, acaricide, fertiliser, growth regulator, and biocide
FieldArm are always keen to take on larger parcels of work and have the capacity, with good discounts on offer. We can offer discounts on parcels of work and/or for trials where you require two years of results. For example if we were awarded trials for 2014 and 2015 (2 seasons) we could offer a % discount on both seasons' trials, and at 2014 prices. Not being a large organisation we can keep overheads to a minimum, and provide you with a quality personal service at competitive rates. We are looking to expand further and hope to offer a GLP service by 2015.
- Fieldbrook Foods Corpfieldbrookfoods.com
Manufacturer of ice cream and other frozen treats!
- Fieldco Limitedfieldcolimited.com
Fieldco Limited is a property transactions company, specializing in property development, leasing & management. We currently manage residential apartments for multinational companies, diplomatic missions & expatriates. In addition we are working on a number of new residential and commercial developments.
- Field Controlsfieldcontrols.com
Field Controls is an industry leader in draft, venting, and combustion air technology. In 2005, they were recognized as Manufacturer of the Year by the National Association of Oil Heat Service Managers.
The company was founded by Ted Field in 1927 in Evanston, Illinois and moved to Kinston, North Carolina in 1977. Field Controls first specialized in large, custom-built draft controls. Field expanded its product line to include venting, combustion and air purification products. The company remains the worldwide leader in the manufacture of draft controls for oil, gas and solid fuel applications.
- Granite Services, Inc.fieldcore.com
Please be advised that Granite Services has recently re-branded as FieldCore. FieldCore is a newly formed company bringing together the field service resources from Granite Services, International, Inc. and GE Power Services into one field services organization. You may learn more about our organization, thought-leadership and career opportunities on the new FieldCore page on LinkedIn or from our company website: FieldCore.com
- Field Days Dog Walking, LLCfielddaysdogwalking.com
Field Days Dog Walking provides personalized and individual pet care services including daily dog walks, puppy care, and vacation care. We are fully bonded & insured, as well as licensed in the city of Chicago. We take pride in our reliability, compassion, and integrity. For further information about our company, background, and services, please feel free to contact us or visit our website! Thanks for viewing and have a great Field Day!
- FIELDEAS Movilidad Empresarialfieldeas.com
Somos la Solución de Movilidad Empresarial.
Conectamos a los trabajadores con su empresa, desde cualquier dispositivo móvil,
con la máxima seguridad, en tiempo real y de la forma más eficiente para su negocio.
Consiguiendo una total Gestión, Visibilidad y Control en sus procesos de negocio.
Soluciones Track&Trace, SAT, Auditorías e Inspecciones, Gestión Comercial, Corporativa, etc
Sectores: Transporte, Energía y Utilities, Retail, Nuclear, Calidad y Seguridad, Administración Pública, etc
- FieldEdgefieldedge.com
Turbocharge your techs, organize your office, save time, and make more money.
FieldEdge, formerly dESCO, is the leading developer of innovative service management software for the service industry. With offices in Fort Myers and Atlanta, FieldEdge serves more than 30 service verticals, both nationally and internationally.
FieldEdge's flagship products, FieldEdge and Electronic Service Control (ESC), are comprehensive service management solutions that enable home service contractor companies to easily manage customers, work, and finances. FieldEdge and ESC provide the tools and features growing and profitable service companies need for success.
- Electrical Companyfieldelectricalservices.co.uk
- Fieldersfielders.com.au
Fielders specialises in the manufacture of innovative steel roofing products, supplying a comprehensive range of steel roll-formed products to the commercial, industrial and domestic building industry, as well as the manufacturing and mining industries.
- FieldEZ Technologiesfieldez.com
FieldEZ transforms customer's field operations and services using digital technologies such as cloud computing, enterprise mobility, data analytics & insights, and IoT integration.
We offer innovative automation solutions for CRM based field force management applications. FieldEZ company's products and services are used by Fortune 100 companies as well as SMEs in Europe, USA, UK and India. Our global customer portfolio includes Samsung, Vodafone, Dell, Adecco, ICICI Bank, Twinings, Wipro and Emerson.
FieldEZ's cutting-edge digital initiatives benefit numerous businesses across multiple industries including IT & Telecom, Healthcare, FMCG & Retail, Banking & Insurance, Consumer Durables, Real-Estate (Smart Cities) and E-Commerce.
Our integrated stack comprises of:
STRATEGIC CONSULTING & SERVICES:
• Field Data Analytics & Insights
• Data Visualization & BI Reporting
• Customer Experience Transformation
• Operations ROI and Value Analysis
• IoT integration
PRODUCTS:
• Field Services Management
• Field Sales Automation
• Retail Workforce Management
• Marketing & Promotions Management
• Attendance and Location Tracking
Founded in 2011, FieldEZ Technologies is part of the $150Mn portfolio of IvyCap Ventures. IDG Ventures, a global network of technology venture funds with more than US$4 billion under management, is another key stakeholder in the digital technology initiatives of FieldEZ.
- Fieldfisherfieldfisher.com
Fieldfisher is a European law firm with market leading practices in many of the world's most dynamic sectors. We are an exciting, forward-thinking organisation with a particular focus on technology, finance & financial services and energy & natural resources.
Our growing European network of offices supports an international client base alongside our Silicon Valley team. Among our clients, we count social media sites and high street coffee chains through to pharmaceutical, life sciences and medical devices companies, energy suppliers, banks and government departments.
Clients choose to work with us because we deliver commercial, pragmatic and innovative solutions through our exceptional legal expertise and experience, on time and on budget.
We have more than 400 lawyers spread over nine locations, all providing highly commercial advice based on an in-depth understanding of our clients' needs.
We operate across our offices in Belgium, China, France, Germany, Italy, the Netherlands, the UK and the US.
- Field Forcefieldforce.cz
Field Force is a company based out of Czech Republic.
- Fieldforce Servicesfieldforce.net.au
Established in 1993, Fieldforce is comprised of a large, passionate in-house team complemented by skilled employees and subcontractors in the field. Our team take pride in working for an Australian industry leader in outsourced field solutions – particularly in relation to our delivery of wide-ranging environmental programs over the last ten years. Our emphasis on ongoing training also means our staff are supported with opportunities to expand their knowledge and skill set at regular intervals. As a result, Fieldforce is arguably in possession of the most talented, committed team in the industry.
Of course, the technical competence of our staff is matched with a focus on delivering superior customer service across all our operations.
The Fieldforce vision is to achieve excellence in everything we do and be the leading provider of outsourced field solutions.
- Field Fresh Foods, Inc.fieldfresh.com
Founded in 1994, Field Fresh Foods Inc has become the leading regional fresh cut processor in the South-Western United States.
Our company produces a wide variety of value added fruit, vegetables and specialty items for the food manufacturing, retail, and food-service industries.
We at Field Fresh Foods are proud of our business principles. At our core you will find a commitment to product quality, safety, and freshness, along with our dedication in providing superior service and value to our customers. Our commitment is far reaching, whether it is through our environmentally friendly sustainable practices, our support of local food drives, as well good steward and ambassadorship within the community.
- FieldFresh Foods Private Limitedfieldfreshfoods.in
FieldFresh Foods Private Limited is a joint venture between Bharti Enterprises & Del Monte Pacific Limited. With a vision of 'Creating Delightful Food experiences', FieldFresh Foods offers a range of food and beverage products under the Del Monte brand in India and select SAARC countries, while exporting fresh and processed vegetables like Baby Corn, Sweet Corn, Chillies etc to UK and western Europe. We also export core sauces & condiments to international QSR's in 12 markets in Asia Pacific.
We take great pride in a world class manufacturing and R&D center for Del Monte range of products at Hosur, near Bengaluru. This facility recently won the CII National award for Food Safety and Quality, a just recognition for this outstanding facility. This state-of-the-art facility manufactures a range of Fruit Drinks, Sauces, Dips, Dressings and Condiments.
The plant has fully integrated & highly automated lines consistently producing high quality products which remain untouched by the human hand. The R&D facility at Hosur drives innovation and customized solutions for our B2B customers. With an outstanding infrastructure and tremendous focus on quality and innovation within a short span, Del Monte serves all international QSRs like Domino's, Pizza Hut, KFC, Subway, McDonalds, Burger King etc in India besides being a preferred supplier to the Food Service channel and being available to consumers across the top 70 cities in nearly 50,000 top modern trade and general trade outlets.
- Fieldgate Homesfieldgatehomes.com
Fieldgate Homes is proud to be building communities all around the Greater Toronto Area, not just great homes. 3 generations of innovation, creativity and family values go into every community that we build.
The Fieldgate management team places a high value on personal growth and achievement in serving our purchasers and carrying out our corporate goals. Past experiences become lessons for the future and motivation for change and improvement. This business philosophy is reflected in each project we undertake and has earned us recognition and praise from homeowners and industry professionals alike.
- FieldGlobal Market Research Pvt Ltdfieldglobal.com
We are a global provider of end-to-end Market Research & Fieldwork solutions.
We have grown from being Asia's leading Multi-country Agency to a truly intercontinental data collection specialist.
With an on the ground presence in 11 markets we are strategically placed to cover the MR capitals and emerging hubs of the industry.
We are currently operating from US, UK, China, India, UAE, Indonesia, Thailand, Singapore, Philippines, Bangladesh and Morocco.
Our vision is to be recognized by clients for the quality and consistency of our services.
Qualitative: we have set-up our own benchmark for Qualitative research by delivering 100% back-check through synchronization of various methodologies.
With a strong team of domain expert moderators and premium facilities located in central venues we have the structure, the processes and expertise to carry out demanding qualitative programs.
Quantitative: we cover all MR segments for Quantitative projects (B2B, B2C, C-Level interviews and large scale consumer surveys) ad hoc and trackers.
We provide support to leading MR agencies as well as smaller and more specialised firms.
From our international CATI centres or via our proprietary panels we focus on providing a seamless and efficient in-house data collection service.
Our approach:
We also believe in the value of relationships, personalising our services and our approach to each project and account. By playing an active role early in the cycle of the project we can recommend the optimal methodology and design a relevant roadmap to success.
- Fielding Graduate Universityfielding.edu
Fielding Graduate University is an accredited nonprofit leader in blended graduate education, combining face‐to‐face and online learning. Our programs offer quality degrees and courses for professionals living and working around the world. Fielding's faculty members represent a breadth of scholarship and practice within the fields of clinical and media psychology, human and organizational development, and educational leadership. Faculty are mentors and guides to self‐directed students who use their skills to become powerful and socially responsible leaders in their communities, workplaces, and society.
- Field Lawfieldlaw.com
Field Law is a western and northern regional law firm, recently voted as a Top 10 firm in Canada by Canadian Lawyer, with offices in Calgary and Edmonton, Alberta as well as Yellowknife, Northwest Territories.
More than 100 lawyers work together to provide a wide variety of legal services to businesses and institutions in corporate and commercial matters, litigation and dispute resolution, labour and employment, insurance, energy, privacy, professional regulatory and medical malpractice issues. Additionally the firm provides private services to individuals including estate planning services and real estate transactions.
Field Law is a member of State Capital Group, allowing clients access to trusted, dependable legal representation anywhere in the world their business takes them.
- FIELDMOTION Ltdfieldmotion.com
Fieldmotion was designed by field workers for field workers!
Our intuitive, easy to use Mobile Workforce Management platform is helping to transform companies around the globe by improving efficiency, saving on over head costs and even helping them MAKE MORE MONEY!
The need for real time information in business is now more important than ever! It's no longer acceptable to wait days or even hours to receive information from your mobile workforce. Delayed information is costing companies thousands! Competitors are beating them to the punch! Fieldmotion has the solution!
Schedule planned and reactive work sending it directly to your field workers mobile or digital device, improve communication between the office and your mobile workforce, capture and send information instantly, make real time decisions and TAKE BACK CONTROL OF YOUR BUSINESS!
Can you really afford to keep doing business the same old way??
Schedule your demo today and take your business to the next level! http://bit.ly/RequestFieldmotionDemo
- The Field Museumfieldmuseum.org
The Field Museum is an educational institution concerned with the diversity and relationships in nature and among cultures. It provides collection-based research and learning for greater public understanding and appreciation of the world in which we live. Its collections, public learning programs, and research are inseparably linked to serve a diverse public of varied ages, backgrounds and knowledge.
- Field Nationfieldnation.com
Field Nation is the complete Field Service Marketplace and Project Management solution that connects businesses and contingent workers. We enable companies to find, hire and pay service technicians when - and where - there is work to be done. Field Nation serves as a catalyst for growth and ensures successful collaborations in today's rapidly changing world of work.
For more information visit www.fieldnation.com
- FGAfieldone-china.com
FGA is a company based out of China.
- Field Outdoor Spacesfieldoutdoorspaces.com
Field Outdoor Spaces is a full-service landscaping company in Minneapolis. We strive to create, revitalize and maintain outdoor spaces that enhance your everyday lives.
Whether it's an urban garden that greets you with color, a backyard patio for summer entertaining, a garden water feature bringing tranquility to your backyard or a natural rock path leading visitors to your doorway, Field's attentiveness and passion for landscape and garden design can help bring your landscaping dreams to life.
- Field Packaging Group, LLCfieldpackaginggroup.com
Field Packaging Group, LLC is a Packaging and Containers company located in 5555 W 73rd St, Bedford Park, Illinois, United States.
- Fieldpiece Instruments do Brasilfieldpiece.com.br
A Fieldpiece Instruments projeta instrumentos de teste exclusivamente para técnicos de HVAC/R. A Fieldpiece foi a pioneira na criação da expansibilidade modular, um conceito em que um único medidor pode utilizar vários módulos diferentes para testar a maioria dos parâmetros que os técnicos de HVAC/R usam no dia-a-dia.
- Fieldpoint Privatefieldpointprivate.com
We are a boutique private bank and wealth advisory firm established in the early days of the financial crisis by 31 individuals including former Chairman and CEOs of some of the most well known and successful financial and consumer firms in America. Their intent was not to craft a firm that would emulate the large, established institutions, but to serve as an alternative.
It would be boutique by design.
It would feature the intellectual capital of only highly experienced advisers and senior investment, wealth planning and banking professionals.
It would reside not as a department within a large firm engaged in many other businesses, but as an independent firm built from the ground up to deliver highly customized, integrated wealth strategies for significant clients and institutions.
It would recognize that the elements of families' financial pictures are not discrete and disconnected, but interdependent and therefore worthy of advice and reporting that is thoroughly integrated across the balance sheet, regardless of where accounts reside.
And it would decline to engage in proprietary trading, in-house investment products, and any form of compensation from outside investment managers.
Fieldpoint Private has more than $3 billion in assets under administration, and 60+ employees across two offices, New York City, and our headquarters in Greenwich, CT.
Watch our story: http://www.fieldpointprivate.com/founders-video
Readers please note that third-party posts do not reflect the views of our firm.
- Field Projects Internationalfieldprojects.org
FPI is dedicated to conducting long-term research and conservation, while providing training and education, in some of the Earth's most bio-diverse and threatened habitats.
- Fields Auto Groupfieldsauto.com
Fields Auto Group is North America's Premier Luxury Auto Group! With 32 franchises at 20 locations, we are proud to serve our customers in Florida, Illinois, Wisconsin, North Carolina and British Columbia. Family owned and operated, Fields Auto began with the opening of Fields Cadillac in Evanston, IL in 1971.
Currently, we represent BMW, Mercedes-Benz, Land Rover, Range Rover, Volvo, Rolls-Royce Motorcars, Bentley, Lamborghini, Jaguar, Infiniti, Fisker, MINI Cooper, Volkswagen, Jeep, Chrysler, Dodge and Cadillac. We also carry an extensive selection of pre-owned vehicles, many of which have extended warranties thanks to manufacturers' Certification Programs.
Everyone who purchases or leases a vehicle from Fields Auto Group is entitled to complimentary loaner vehicles with service appointments, as well as free car washes for the life of the vehicle. Our commitment to building long term relationships with our customers has enabled Fields to grow from a single store in 1971 to North America's premier luxury auto group. We specialize in ensuring that our customers get the right vehicle and packages not only for their driving needs and budget, but for their lifestyle as well.
- FIELDS Chinafieldschina.com
FIELDS is a Shanghai-based online grocer founded in 2009, in response to food safety concerns in China. FIELDS provides healthy and safe options for all your grocery needs, including fresh organic and non-organic fruit and veg, imported and domestic meat and seafood, beverages, dairy, (including artisanal, hand cut cheeses), baked goods, plus essential pantry items from home.
With same-day delivery in Shanghai, FIELDS makes it convenient and affordable for you to have fresh, seasonal and imported food items in China. Other cities can also enjoy a fast delivery service every week.
@ FIELDS, WE:
1. Offer only high quality, safe and consistent products
2. Prioritize our customers in everything we do
3. Support and reward an excellent, motivated team
4. Develop sustainable growth
5. Promote healthy lifestyles
6. Protect our environment for the long-term
7. Treat suppliers as partners
8. Respect and value intellectual property
9. Believe in hard work as the driver of good results
10. Do not tolerate corruption
- Fields Jewelersfieldsjewelers.com
Fields Jewelers is a Logistics and Supply Chain company located in 2406 New Holt Rd, Paducah, Kentucky, United States.
- Fields Manufacturingfieldsmfg.com
The Fields family of companies is a 5 star supplier in business for over 35 years gaining the knowledge and experience to better serve our partners.
We are committed to providing you with quality promotional products which is only surpassed by our award winning customer service.
INDUSTRY RECOGNITION:
• ASI 5 Star Supplier
• PPAI Supplier Star Award
• ASI Distributor Choice Award (2015-2017)
• Promo Marketing Supplier Excellence Award
CORE CATEGORIES:
• Lanyards
• Bags
• Awareness Guides
• Coloring Books
• Sunglasses
• Safety Glasses
• Stress Relievers
• Writing Instruments
• Wristbands
• Adhesive Notepads
• Drinkware
• Buttons
• Hand Fans
• RFID Blockers
• Seed Paper, Packs and Planters
FAMILY OF COMPANIES:
• Fields Manufacturing
• Targetline
• Better Life Line
• American Greenwood
• Sprout Tyme
Service | Quality | Commitment
- Fields of Viewfieldsofview.in
Can policymaking be made more relevant to the lives of people affected by it? Can policymaking be more responsive to the constantly changing social-economic-environmental context? Can we reduce the time taken for a policy to go from the drawing board to implementation? The answer to all these questions is yes, provided we have the right set of tools. Our goal thus at Fields of View is to undertake research at the intersection of technology, social sciences, and art to design these tools for policymakers and people.
Curious to know more? Mail us at : [email protected]
Fields of View is a non-profit organisation, registered under the Karnataka Societies Registration Act, 1960. We are currently based out of JP Nagar Phase 2, Bangalore.
- Fieldsports Ltd.fieldsportsmalta.com
Fieldsports, is an established private European company, positioned and headlined as a globally integrated, security specialist and service provider engaged in the lawful supply of genuine firearms, ammunition and other related equipment to Private Security Companies. With its wealth of experience, expertise and in-depth specialist knowledge of the industry, Fieldsports delivers the latest defense technologies and unequaled logistic proficiencies thus enabling it to give its customers conceivably the best service in its segment and genre.
The company's very rigorous adherence to industry regulation and international standards has led to its relentless drive to meet the ever more demanding maritime security challenges of the century. It offers the highest level of bespoke solutions to its global partners, ranging from premium security equipment, supply chain management solutions, maritime security intelligence, and project management.
The company is geared to respond anywhere in the world via its 24/7 Operations center, assisted by its regional representative offices in Malta and Djibouti. Fieldsports' teams of experienced specialists work relentlessly to garner a comprehensive understanding of their clients' requirements at all times, guaranteeing peace of mind.
- Field Srlfieldsrl.it
FIELD is a Service Company dedicated to the Geotechnical, Civil and Structural Engineering, specialized in providing equipment, tests, measurement and monitoring systems.
FIELD, founded in 1999 with its headquarters in Lallio (Bergamo), since the beginning has become a market leader, both nationally and internationally, in the geotechnical and civil Engineering sectors supplying with customers equipment, tests, measurement and monitoring systems.
FIELD intends to support the operators of: public and private Institutions, general and specialized firms, Technical Studies and Engineering Companies, Professionals and Consultants.
FIELD obtained its own quality management system certification according to the UNI EN ISO 9001:2000 standard for: design and production of monitoring systems in geotechnical, geomechanical, hydrological and civil engineering fields; on site geotechnical tests and measurements; geotechnical equipment assistance, rental and supply.
FIELD obtained, moreover, the QUALIFICATION CERTIFICATE TO PERFORM PUBLIC WORKS for the following reference classes: Cat. Class.
OG12 II
OS20 I
OS21 I
- Field Station: Dinosaursfieldstationdinosaurs.com
Field Station: Dinosaurs is a world-class family attraction that combines cutting-edge science with the creative minds of great artists and teachers to create a one-of-kind experience that's thrilling, educational and fun.
The Field Station is a wild scientific expedition just minutes from New York City. Over thirty life-sized, realistic dinosaurs come to life thanks to the brilliant engineering of the world's leading roboticists and the imagination of our artists.
The story of the dinosaurs is vividly presented in Bergen County's beautiful Overpeck Park, on the banks of a scenic creek and surrounded by natural woods. Scientists have worked to ensure that the exhibition encompasses the latest theories and discoveries in the fields of paleontology, geology, and environmental studies.
Workshops, games and activities connect the story of the dinosaurs to our world today, giving new relevance to their lives, and power to the tale of their extinction.
And at the center of it all is the fun, the joy and the wonder of dinosaurs. Our expedition takes every family on a shared adventure - full of mystery, surprise and a sense of awe.
Walk along our trail, check out our 32 life-sized dinosaurs and participate in over forty live shows, games and activities, which are all included in the Day Pass admission price, with the exception of Sea Rex: Journey to a Prehistoric World, which is an additional $5 when purchased at the door. The movie is included in the Explorer's Pass and Season Pass.
- Fieldstone Homesfieldstonehomes.com
• Fieldstone Homes Utah ("Fieldstone Utah") – A Homebuilding and Land Development Company.
• Fieldstone Utah has a dual future strategy of both homebuilding operations and land sale operations (the
acquisition of raw land for entitlement, development and sale).
• Fieldstone Utah is a privately owned company capitalized with a combination of ownership equity, project
level joint venture equity, long-term debt and project level secured loans
• Fieldstone Utah's offices are located in Draper, Utah.
Companies within The Fieldstone Group of Companies ("TFG") have conducted operations in homebuilding, land development, land entitlement and related businesses since 1981. Since its founding, TFG has constructed and sold more than 35,000 attached and detached homes in hundreds of communities in Southern California, Texas and Utah for a total sales volume of over $6.2 billion.
In 2013, TFG made the decision to focus its future operations in the greater Salt Lake City area of Utah. Fieldstone Utah's strategies include land operations (entitlement, development and lot sales) and homebuilding operations.
Fieldstone Utah has constructed and sold a variety of product types (primarily detached homes, but also including attached homes) at various price points and in various locations in Salt Lake City and surrounding areas.
Fieldstone Utah has a strong industry reputation, provides a motivating, rewarding and family friendly work environment and operates according to its core values that include:
• Excellence in Everything we do
• An Environment of Teamwork and Trust
• The Value of each Employee
• Commitment to our Homebuyers
• The Importance of Profitable Operations
• Integrity in the Conduct of our Business
This combination of operational strengths, strong values and competitive strengths have resulted in Fieldstone Utah becoming one of Utah's most highly ranked and trusted home builders in Utah.
- Fieldstone Propertiesfieldstoneinvestments.com
Fieldstone Properties LLC. (FSP) is a privately held Boston based Real Estate Investment Company that engages in the acquisition and ownership of portfolios that consist of but not limited to
Multi-family, Mix-use, and Apartment Buildings throughout the Great Boston and North Shore areas of Massachusetts.
www.fieldstoneinvestments.com
- Fieldstone Mortgage Companyfieldstonemortgage.com
- Fieldstone Realty Partnersfieldstonerp.com
Fieldstone Realty Partners and our associates provide full service residential real estate services to many leading developers, builders and investment companies throughout Atlanta. We have built a team of professionals with a vast and diverse experience to bring knowledge to how to help our clients make educated business decisions with their property.
We partner with our clients in a complex real estate market by providing land brokerage service, development knowledge, proactive community association management and asset management to our clients protecting and enhancing the value of the communities.
For professional management, land brokerage service and expertise in adding value to your real estate, contact Fieldstone and find out how our services add value — from the sales and selection process to the lifestyle of a community.
- Field Technical Servicesfieldtesting.com
Leadr in Real World Mileage Accumlation
- FieldTurffieldturf.com
FieldTurf is the inventor and world leader in infilled artificial turf with over 5,000 installations in North America and over 10,000 worldwide. In the NFL, 22 of 32 teams have selected FieldTurf for their game and / or practice facilities while hundreds of NCAA D-1 programs play and/or practice on FieldTurf, including such powerhouse programs as Illinois, Louisville, Michigan, Missouri, Northwestern, Notre Dame, Ohio State, Oregon, Texas, Washington, and Washington State among others.
Across the globe, high-profile clubs and professional associations opt for FieldTurf, among them Paris Saint-Germain FC, FC Barcelona, FC Groningen, Newtown AFC, AFC Ajax, Borussia Dortmund, Sutton United FC, St Johnstone FC, Kilmarnock FC, Stenhousemuir FC, QPR, US Oyonnax, Cardiff Blues and Clairefontaine French national training center. FieldTurf is a partner of FIFA, World Rugby, FIH, ITF and FFF, and a member of ESTO.
FieldTurf is part of Tarkett Sports, a Division of the Tarkett Group. Tarkett Sports is the largest entity in the sports and landscape surfacing industries. Included within the Tarkett Sports portfolio is an impressive range of performance sports flooring products. This product range includes: synthetic and hardwood basketball; volleyball and gymnasium flooring; squash and racquetball courts; floor protection and covering systems; weight room flooring; and high performance indoor and outdoor running tracks, featuring Beynon and Atlas track surfaces.
- Fieldfieldux.com
Field is built on this golden rule: you can't guesstimate or rely on assumptions. We believe in the power of knowing. We believe in learning from customer research early and often no matter the product, business, or objective.
We believe it because we've seen it work countless times. It's why we do what we do.
Our Atlanta-based user experience studio helps healthcare and wellness technology businesses understand their customers through sound, well-designed qualitative research. Our brand of research isn't about surveys. It's not about logging numbers. And it's certainly not about reading through questions and checking boxes.
It's about having a quality conversation, building a dialogue, and listening so that people open up, say what they want to say, and offer true insight.
In practice, we dedicate all of our creative energy to making a positive impact on the world around us. Whether it be on an individual, social, or environmental level, our work reflects what we believe in: truth, transparency, empowerment, authenticity, and empathy.
- Fieldwirefieldwire.com
Fieldwire is a field management platform designed for construction. The application powers over 200,000 projects worldwide allowing field workers to access up-to-date information like blueprints, files and tasks directly on their mobile device.
Fieldwire focuses on the effective collaboration of field workers around three core use cases:
- Plan viewing & versioning with collaborative markups
- Issue tracking with regular and 360-degree photos, annotations, check lists
- Task management & scheduling
Fieldwire works both offline and online allowing users to continue working in conditions where little or no network connectivity is available.
- Fieldwork, Inc.fieldwork.com
Fieldwork is a leader in world-class marketing research services and studios.
Fieldwork has 15 studios across the US, with onsite recruiting, local databases and experienced project managers.
Fieldwork Network is a group of dedicated project managers that field multi-city projects across the globe, one point of contact from proposal to invoice.
Fieldwork Anywhere can create a fully equipped studio in any town or in any venue. The service includes recruiting, recording, hosting, and fully equipped observation area.
Fieldwork Webwork provides all of the tools and support needed for online research, with a team that understands the ins and outs of the market research industry.
Fieldwork National Recruiting Center (NRC) can recruit respondents to any location in the US.
- fieldwork RIOTINTOfieldworkriotinto.com
fieldworkRIOTINTO tiene como objetivo dar a conocer la Cuenca Minera de Riotinto (Huelva) en particular, y la Faja Pirítica en general, facilitando el contacto directo con un paisaje único y descubriendo su singularidad por nosotros mismos.
Desde dar a conocer nuestra riqueza patrimonial y cultural mediante paseos, rutas y senderismo por nuestro entorno urbano y natural; con la organización de eventos temáticos que nos permitan conocerla, visualizarla y disfrutarla en su propio contexto; poniendo en valor sus cualidades a través de un trabajo de investigación que nos ayude a contribuir a su difusión y reconocimiento; realizando una función docente con la que trabajar con las generaciones futuras el conocimiento de su propia tierra y con ello su respeto y defensa; y, por último, una
labor eminentemente editorial con la que encauzar nuestros proyectos y los ajenos con el fin de que lleguen al público.
Formado por geólogos e historiadores con amplia experiencia en la docencia e investigación así como en las distintas ramas de la profesión (minería, cartografía, archivística y guías turísticos) fieldworkRIOTINTO es un proyecto que auna la pasión por nuestro profesión como por el entorno de la Cuenca Minera de Riotinto (Huelva). Es nuestro objetivo difundir su Patrimonio tanto entre el que nos visita como entre los que viven en el, uniendo la realización de rutas de senderismo con actividades de investigación, divulgación y docencia.
Inscrita en el registro de la Consejería de Turismo y Comercio con el número: AT/HU/00055, en fieldworkRIOTINTO trabajamos día a día convencidos de que todo cuanto ofrece la Cuenca Minera de Riotinto es una garantía para el desarrollo de la comarca y va acompañada de un trabajo serio y profesional.
- FIELFALT UG (haftungsbeschränkt)fielfalt.de
FIELFALT ist eine ganzheitliche Plattform für Frauen, die etwas wagen wollen. FIELFALT ist eine Community, Weiterbildungsplattform, Jobbörse und ein Online-Blogazine.
Die Gründerinnen Aimie-Sarah Carstensen und Kira Siefert versammeln dazu Frauen aus allen Branchen und Berufen. Ein Kernthema, das sich bei allen Aktivitäten von FIELFALT immer wiederfindet: Jede Frau ist einzigartig und sollte sich dieser Einzigartigkeit bewusst sein. Sie soll mutig sein und selbstbewusst. Sie soll ihr Leben selbst in die Hand nehmen und etwas wagen. Beruflich, aber auch privat. Das wichtigste Ziel aller Netzwerkbemühungen - so auch unserer - ist die Gleichberechtigung beziehungsweise Chancengleichheit von Frauen.
- Fielmann Ventures GmbHfielmann-ventures.com
Innovative technologies and sustainable business models for the eyewear industry
Founded in August 2012, Fielmann Ventures is a wholly owned subsidiary of Fielmann AG. We seek out, develop and support products, technologies and sustainable business models for the future of the eyewear industry.
Fielmann Ventures bridges the gap between Venture Capital, incubator and start-up for the eyewear industry. We derive new ideas by evaluating technological innovations and market developments against their utility for our customers. We execute new business ideas independently and support projects with knowledge, scaling expertise and Venture Capital.
Inspired by the Lean Startup methodology, Fielmann Ventures employs a hypothesis-driven, data-based approach to evaluate the feasibility and merit of potential projects: We rapidly develop Minimum Viable Products (MVPs) and subsequently test them in interaction with our customers, opticians and other industry experts, making sure that they meet actual needs.
- Fiel Pet Comercio De Produtos Agropecuariosfielpet.com.br
- FIEMAfiema.org.br
- FIEMGfiemg.com.br
O Sistema FIEMG trabalha para contribuir efetivamente com a indústria mineira, buscando resultados que sustentem sua competitividade. Isso é possível através dos serviços e produtos oferecidos pelas cinco empresas que o compõem: Federação das Indústrias do Estado de Minas Gerais (FIEMG), o Centro Industrial e Empresarial de Minas Gerais (CIEMG), o Serviço Social da Indústria (SESI), o Serviço Nacional de Aprendizagem Industrial (SENAI) e o Instituto Euvaldo Lodi (IEL). Juntas, essas empresas oferecem à indústria mineira estratégias para o desenvolvimento industrial.
O Sistema FIEMG trabalha para que a indústria mineira se torne cada vez mais competitiva, inovadora e sustentável, capaz de gerar novos negócios, riqueza e desenvolvimento. Uma indústria que se destaque no Brasil e no exterior, e que seja o motor para o crescimento econômico e social de toda Minas Gerais.
- SENAI MSfiems.org.br
O SENAI – Serviço Nacional de Aprendizagem Industrial - entrou em funcionamento em Mato Grosso do Sul no dia 1° de fevereiro de 1949 e foi inaugurado em 21 de maio do mesmo ano em Campo Grande, pelo Engenheiro Roberto Mange, um dos idealizadores do
SENAI.
A missão do SENAI em Mato Grosso do Sul é promover a educação profissional e tecnológica, a inovação e a transferência de tecnologias industriais, contribuindo para elevar a competitividade da indústria sul-mato-grossense.
O SENAI/DR-MS funciona como entidade mantenedora dos cursos de Educação para o Trabalho, Formação Inicial e Continuada de Trabalhadores, Educação Profissional Técnica de Nível Médio e Educação Profissional Tecnológica de Graduação e Pós-Graduação,tendo como executoras suas Unidades Operacionais.
- Fien Adviesgroepfien.nl
Wij zijn uw privé adres voor financiële zaken. Financiële dienstverlening is mensenwerk. Onze adviseurs nemen daarom graag de tijd voor u. Zij maken werk van een goed advies. Dat begint bij een gesprek om uw persoonlijke situatie te inventariseren. Op basis hiervan wordt uitgebreid onderzocht wat voor u de best passende oplossing is.
Dit vereist veel vakkennis, ervaring en up-to-date kennis van de markt. Wij kunnen u garanderen dat onze adviseurs aan deze vereisten voldoen. Wij houden voortdurend onze kennis actueel. Onze adviseurs zitten dus regelmatig achter de studieboeken om u van een goed advies te kunnen voorzien.
Kortom: wij laten geen kans onbenut om u van dienst te kunnen zijn.
Op http://driebergen.fien.nl/ kunt u terecht voor meer informatie.
Tel: 0343-518561
- Federação das Indústrias do Estado de Pernambuco - FIEPEfiepe.org.br
A FIEPE é uma entidade criada e mantida pelas indústrias e tem como principal objetivo o desenvolvimento do setor produtivo local. Para isso, oferece produtos e serviços específicos voltados para áreas de consultoria, inteligência comercial e capacitações, por meio das unidades instaladas no Recife, Caruaru, Petrolina e Araripina.
- Fiep - Federação das Indústrias do Estado do Paranáfiepr.org.br
A Federação das Indústrias do Paraná (Fiep) é a entidade de representação da indústria paranaense. Criada em agosto de 1944, a Fiep coordena, protege e representa legalmente as diversas empresas do setor industrial no Estado.
Como resultado da associação de sindicatos empresariais, a Fiep atua juntamente com Sesi, Senai e IEL. Juntos, formam o Sistema Fiep e apoiam com produtos e serviços o parque industrial do Paraná e contribuem para seu desenvolvimento dentro e fora do Brasil.
Missão
Promover a excelência da indústria paranaense para melhorar a qualidade de vida das pessoas.
Visão
Ser reconhecida como entidade empresarial ativa e agente de transformação a favor do desenvolvimento sustentável do Paraná.
- Fierfier.nl
Fier is een landelijk expertise- en behandelcentrum op het terrein van geweld in afhankelijkheidsrelaties. Wij richten ons op slachtoffers, plegers [vaak ook slachtoffer] en getuigen (vaak kinderen).
Onze opdracht is het stoppen van geweld, het voorkomen van geweld en hulp bieden bij de gevolgen van geweld. De wereld is hierbij ons uitgangspunt. Wat gebeurd er in de wereld en wat hebben slachtoffers nodig?
Onze missie is directe hulp aan iedereen die te maken heeft [gehad] met geweld in een afhankelijkheidsrelatie. Wij kijken hierbij naar de mens als totaal: naast zorg en behandeling zetten wij in op familie, vriendschappen, sport, onderwijs en werk. Bij Fier ligt het accent op de toekomst.
We spelen in op actuele ontwikkelingen in de samenleving en nemen een leidende rol bij agendasetting, innovaties en professionalisering op het gebied van geweld in afhankelijkheidsrelaties. Samenwerking is cruciaal bij de aanpak van geweld. We investeren daarom waar mogelijk in samenwerkingsverbanden, ketens en intersectorale zorgprogramma's.
Fier biedt:
- Beschermde en veilig opvang & behandeling
- Ambulante hulp
- Online behandeling
- Voorlichting & Advies [o.a. chatmetfier.nl]
- Deskundigheidsbevordering & Advies aan professionals vanuit de Fier Academy
Onze specialisaties: kindermishandeling, huiselijk geweld, seksueel geweld, eergerelateerd geweld, achterlating, huwelijksdwang, mensenhandel, loverboyproblematiek, vroegkinderlijke traumatisering en complex trauma, vechtscheidingen, ouderenmishandeling.
Het Centrum tegen Kinderhandel Mensenhandel [CKM] is de NGO tak van Fier. CKM verbindt en bindt de strijd aan tegen kinderhandel en mensenhandel! CKM biedt niet alleen opvang aan slachtoffers van mensenhandel, maar ook begeleiding en behandeling. CKM zet in op de verbetering van de (rechts)positie van slachtoffers van kinderhandel en mensenhandel in de breedste zin van het woord en voor een grotere bewustwording.
www.ckm-fier.nl
- Fiera Capitalfieracapital.com
Fiera Capital offers thoughtful investment solutions across a spectrum of traditional, alternative and bespoke investment strategies, including depth and expertise in asset allocation. Fiera Capital manages approximately CAD$123 billion in assets for high net worth individuals, institutions and individual investors around the world as of September 30, 2017.
Our mission is to be a leading global asset management firm recognized for superior portfolio management, innovative investment solutions and an ability to surpass client expectations. With offices across North America and Europe, the firm and its affiliates have over 600 employees dedicated to servicing our highly diversified clientele.
For more information about Fiera Capital, please visit www.fieracapital.com. For more information about Fiera Capital's U.S. division, please visit www.fierausa.com.
Fiera Capital Corporation, Fiera Capital's parent company, trades under the ticker FSZ on the Toronto Stock Exchange. Fiera Capital Corporation does not provide investment advisory services, or offer investment funds, in the United States or to U.S. persons. In the U.S., asset management services are provided by the Firm's U.S. affiliates, including Fiera Capital's U.S. division, Fiera Capital Inc., which is registered with the U.S. Securities and Exchange Commission (SEC). Registration with the SEC does not imply a certain level of skill or training. Additional information about Fiera Capital Corporation, including the Firm's annual information form, is available on SEDAR at www.sedar.com. Additional information about Fiera Capital's U.S. division is available in its annual Form ADV at www.sec.gov/iard.
For important disclosures related to Fiera Capital, please visit:
http://www.fieracapital.com/en/about_fiera_capital/legal_notice/
For important disclosures related to Fiera Capital's US division, please visit:
http://www.fierausa.com/important-disclosures/#goto-social-media-disclosures
- Fiera Milano SpAfieramilano.it
Fiera Milano is the leading exhibition Group in Italy and one of the top in the world.
Expertise, excellence in professional exhibitions and services and cutting edge facilities, as well as its success in the foremost international conference management, all make Fiera Milano the ideal partner for promotion, development and internationalisation of any company.
Fiera Milano helps companies expand their business opportunities in Italy and abroad; communicate most effectively with reference markets; nurture human capital through continual professional training; share knowledge at high profile conferences.
- Fiera Milano Congressi S.p.A.fieramilanocongressi.it
azienda specializzata nella gestione e strutture congressuali, nella gestione dei servizi per i congressi e nell'organizzazione di eventi, convegni e congressi. azienda giovane, molto aggressiva, business oriented e rivolta principalmente all'incoming del mercato e dei buyers provenienti dall' estero.
- Fierbourg, Centre de formation professionnellefierbourg.com
Fierbourg est un centre de formation professionnelle faisant partie de la Commission scolaire des Premières-Seigneuries. Situé dans l'arrondissement de Charlesbourg, à Québec, le centre offre 18 programmes d'études menant à l'obtention de DEP et D'ASP ainsi que de formations sur mesure réparties dans quatre secteurs d'activités : Administration, commerce et informatique, Alimentation et tourisme, Horticole et Santé. Avec ses installations modernes et son personnel expérimenté, Fierbourg prépare une main-d'œuvre qualifiée et recherchée dans une grande variété de métiers. Le personnel travaille quotidiennement à rendre la vie du centre agréable afin d'accompagner les élèves dans leur réussite.
- Fierce Backbonefiercebackbone.com
Fierce Backbone is a 501c 3 theater company dedicated to developing new dramatic works from inception to final production, using the collaborative workshop process involving our Writers Unit, Actors Unit and Directors Unit.
'The art of writing has for backbone some fierce attachment to an idea.' ~ Virginia Woolf
- Questexfiercecable.com
Questex is a leading global business information company headquartered in Newton, MA. We drive business investment, innovation and demand creation in the markets we serve by bringing investors, buyers, sellers and professionals together through a wide range of business events; inform them through our business information and intelligence products and support marketers with a comprehensive platform of demand generation, lead-gen, branding, digital media, events and marketing products and services produced by our professional staff and delivered worldwide.
Questex serves the key economic sectors and industries that are driving economic growth, business investment and employment around the world. Within the Consumer Services & Retail sector, Questex serves the travel, hospitality, beauty, spa, fitness, restaurant, nightclub and bar home entertainment and retail industries. Our High Technology sector focus includes global telecommunications, sensors, M2M and mobile as well as enterprise I.T., software and services. Our Life Sciences & Healthcare sector covers every aspect of the pharmaceutical, biotech and medical device industries as well as healthcare technology and the healthcare provider, payer and regulatory markets. The company's properties include over 100 digital media products and over 50 conferences, tradeshows and events, as well as a range of business information and intelligence products. The company's businesses are managed by 400 professional staff through the Questex, FierceMarkets, and ExL Events operating divisions, with offices located throughout the United States of America, Europe and the Asia-Pacific region.
- Fierce Fitnessfiercefitness.com
We offer ongoing fitness kickboxing classes and Commit to Be Fit™, a specialized fitness and nutrition program for both men and women.
Kickboxing fitness has been proven to be one of the best total body workouts you can find. We have fun, exciting fitness kickboxing classes appropriate for all ages and abilities, whether your goal is to get fit, burn fat, feel stronger or look great.
But just working out isn't enough to get most people to their goals. Nutrition can account for more than 60% of your results in a program that burns fat and builds lean body mass. This need resulted in Commit to Be Fit,™ a 6-week program that combines a straightforward, easy-to-follow nutrition program with fun, gut-busting sweat-pouring workouts.
Over the last few years, we've had literally hundreds of normal everyday people get extraordinary results through Commit to Be Fit™.
We are dedicated to providing a safe, supportive environment with personal coaching and accountability. In addition, camaraderie from other people just like you helps you stay feeling positive and motivated!
- FIER EN FORTfierenfort.nl
FIER EN FORT
Interim | Advies | Coaching
Met bezieling begeleidt FIER EN FORT organisaties en medewerkers in koers- en gedragsverandering.
Doen waar je goed in bent, waar je voor staat en daar volledig voor gaan. Zulk handelen maakt trots, inspireert en geeft vertrouwen. Trots op wie je bent, wat je doet, bereikt hebt en nog wilt worden.
- FIERGSfiergs.org.br
FIERGS currently has 113 affiliated associations and CIERGS has more then 2,000 associates. They both have the same president, as a sign of their joint origins, and together they represent the 41,000 factories working in Rio Grande do Sul, which directly employ 600,000 people.
- Federação das Indústrias do Estado do Rio Grande do Nortefiern.org.br
Inserido no Sistema Indústria nacional, liderado pela Confederação Nacional da Indústria (CNI), o Sistema FIERN é composto por quatro instituições que atuam em conjunto pelo desenvolvimento da indústria norte-rio-grandense, que são:
- Federação das Indústrias do Estado do Rio Grande do Norte (FIERN)
- Serviço Social da Indústria (SESI)
- Serviço Nacional de Aprendizagem Industrial (SENAI)
- Instituto Euvaldo Lodi (IEL)
A Federação conta com 27 sindicatos patronais filiados. Atualmente, o Sistema FIERN é presidido pelo industrial Amaro Sales de Araújo.
Missão
"Fortalecer a indústria, atuando na representação e defesa de seus interesses, na promoção da educação profissional e qualidade de vida do trabalhador e no desenvolvimento tecnológico e empresarial, propiciando a melhoria da competitividade das empresas industriais do Rio Grande do Norte, de forma sustentável"
Visão do Sistema FIERN
"Consolidar-se como líder na promoção da competividade da Indústria, fomentando o desenvolvimento sustentável do Rio Grande do Norte"
- SESI - Serviço Social da Industria DR/ROfiero.org.br
Fazem parte de todo contexto da FIERO/RO no estado de Rondônia:
Federação das Indústrias do Estado de Rondônia - FIERO;
Serviço Social da Indústria - SESI RO;
Serviço Nacional de Aprendizagem Indústrial - SENAI RO;
Institudo Evaldo Lodi - IEL RO.
Faço parte desse grupo desde outubro de 2007.
A área que atuo é o Recursos Humanos.
- Zeefdrukkerij Fiers bvfiers.nl
Screen and Pad print company wich has worldwide clients in all sorts of ranges. Our many years' of experience with all kinds of materials and usage of all printing possibilities on those materials, makes us a valueable partner
for all of our industrial clients. We find the printing solution wich fits exactly to our clients products.
We can advise, print with several methodes, add all kinds of adhevises, packed with or without protection foil, label each part with the information our clients want and pack the way our client prefers.
- Fiery Fourfieryfour.be
- FIESC - Federação das Indústrias de Santa Catarinafiesc.com.br
The purpose of the FIESC System is to strengthen Santa Catarina industry. Maintained by the companies in the sector and administered with the same criteria for excellence applied to management at the best private companies, it is composed of five entities, with specific missions: the Federation of Industries of Santa Catarina State (FIESC), The Industrial Social Service (SESI/SC), The National Industrial Educational Program (SENAI/SC), The Santa Catarina Center of Industry (CIESC) and The Euvaldo Lodi Institute (IEL/SC).
- Federação das Indústrias do Estado de São Paulo - FIESPfiesp.com.br
A Federação das Indústrias do Estado de São Paulo (Fiesp) é a maior entidade de classe da indústria brasileira. Representa cerca de 130 mil indústrias de diversos setores, de todos os portes e das mais diferentes cadeias produtivas, distribuídas em mais de 130 sindicatos patronais.
A atual estrutura da Fiesp reflete o pensamento estratégico e o tratamento homogêneo que a entidade confere às várias cadeias produtivas e aos sindicatos, independentemente do porte das empresas ou do segmento a que pertencem.
A Fiesp conta com 11 Conselhos Superiores Temáticos, coordenados pelo Instituto Roberto Simonsen (IRS).
Os Conselhos Superiores Temáticos traçam diretrizes para os trabalhos dos departamentos: de Competitividade e Tecnologia (Decomtec), de Infraestrutura (Deinfra), de Pesquisas e Estudos Econômicos (Depecon), de Relações Internacionais e Comércio Exterior (Derex), de Meio Ambiente (DMA), Jurídico (Dejur), do Agronegócio (Deagro), de Ação Regional (Depar), de Segurança (Deseg), da Indústria da Construção (Deconcic), da Indústria da Defesa (Comdefesa), da Micro, Pequena e Média Indústria (Dempi) e, ainda, o Departamento Sindical (Desin) e a Central de Serviços (Cser).
Em todo o Estado de São Paulo, a Fiesp é representada por 51 diretorias regionais.
Para garantir crescimento harmônico das diferentes cadeias produtivas, também foram criados Comitês para os seguintes setores: cadeia produtiva da Biondústria (BioBrasil), do Desporto (Code), da Biotecnologia (Combio), de Couro e Calçados (Comcouro), da Mineração (Comin), do Papel, Gráfica e Embalagem (Copagrem), da Pesca e da Aquicultura (Compesca), Petróleo e Gás (Competro), da Saúde (Comsaude) e da Indústria Têxtil, Confecção e Vestuário (Comtextil).
Há ainda os Comitês de Jovens Empreendedores, de Ação Cultural e de Responsabilidade Social.
- Kent Fiestafiesta.com.tr
Kent-Fiesta is a manufacturer and exporter company which aims minimal prices for optimal quality. Kent-Fiesta manufactures different ovens and cookers according to requirements since 1995. Until today, Kent-Fiesta manufactured and exported Ovens & Cookers more than 50 countries. Almost 80% of the production has been exported.
Wide range of alternatives and applications on our products are satisfactory to variety of demands of various users. Also OEM production can be considered to penetrate higher sales at target market. Kindly note that we can make any kind of Gas and electric applications on oven according to your requirements.
- Fiesta Bowlfiestabowl.org
As a nonprofit focused on fostering a culture of community involvement and giving, the Fiesta Bowl Organization hosts a variety of local events, as well as two elite bowl games a year - the Fiesta Bowl and the Cactus Bowl. A long-standing tradition, the Fiesta Bowl is dedicated to cultivating a culture of community outreach and philanthropy, through which we strive to make Arizona a better place to live, work and play.
In an effort to help enhance Arizona communities through youth, sports, education and human services, Fiesta Bowl Charities committed more than $1.5 million throughout the 2015-16 season to nonprofit organizations across the state.
For more information about the Fiesta Bowl, visit FiestaBowl.org or call 480.350.0900.
- FIESTA GROUPfiestagroup.com
As Fiesta Group, our goal is to make each and every business opportunity a valuable relation providing our customers with the latest products of the industry. We have been providing the Lebanese and Arab market with top quality decoration and entertainment products for almost 18 years.
With 7 departments, over 50 employees, 3 retail outlet stores, and a huge production facility, we have been at the top of this industry, being committed to all our customers' requests.
Fiesta's departments are:
1- Styrofoam Decoration
2- Balloons
3- Gift & Wrap (handmade items)
4- Fireworks
5- Fiesta World (kids birthdays)
6- Fake Cakes
7- FiestaVille (birthday venue, daycare center, nursery for Junior VIPs)
- Fiesta Innfiestainn.com
Fiesta Inn es una marca de hoteles de negocios propiedad de Grupo Posadas, fundada en 1992.
Actualmente cuenta con 62 hoteles y 8,871 habitaciones, y recibe a más de 2'100,000 huéspedes al año, lo que la convierte en una de las marcas con más participación en el segmento de negocios.
Historia
Fiesta Inn, fundada en 1992, es la primera marca mexicana de hoteles de negocios. Las primeras aperturas fueron Fiesta Inn Chihuahua y Xalapa Las Ánimas.
En 2002, Fiesta Inn incluye en sus hoteles el programa de lealtad Fiesta Rewards, el cual ofrece a sus huéspedes recompensas por sus estancias.
En 2009, se implementa el servicio de Business Concierge en todos los hoteles Fiesta Inn; con la creación de este puesto, se estandariza el servicio y la atención a los huéspedes. Además, se hace el relanzamiento del programa de lealtad Fiesta Rewards, renovado con mayores beneficios como estancias, puntos del programa y promociones, así como un uso sencillo para sus socios.
En 2010, Grupo Posadas moderniza su imagen y logotipo, para ir más acorde con las tendencias del mundo hotelero y de negocios. Estos cambios organizacionales trascienden también en las marcas del Grupo, mejorando el servicio personalizado y la atención a los huéspedes en cada hotel, para asegurar una excelente estancia.
En 2011, se lanza la nueva imagen de Fiesta Inn con un logo desarrollado de acuerdo con las tendencias actuales.
- Fiesta Mart, Inc.fiestamart.com
Fiesta Mart, Inc. is an international grocery store chain based in Houston, Texas with locations in Houston, Dallas, Fort Worth, and Austin. We strive to give our customers friendly and helpful service, a wide variety of products from around the world, and a good value for the products they purchase.
As our name suggests, Fiesta is a fun place to work and shop; in fact, celebrating is a component of our strong culture as are a strong commitment to customers, integrity, experience and intuition, respect, pride, sense of family, two-way communication, agility, and risk-taking.
We are a growing company and are always looking for experienced leaders in the retail grocery industry who are inspirational and have a proven record of building teams and developing people. And, we're on the lookout for energetic people who are highly motivated to start a successful career.
- Fiesta Americana Puerto Vallarta All Inclusive & Spafiestamericana.com
Con el encanto y la calidez que han hecho único a este destino, Fiesta Americana Puerto Vallarta es, sin duda, uno de los hoteles más atractivos en Bahía de Banderas, la segunda más grande del Pacífico. De arquitectura mexicana contemporánea, su hermosa construcción armoniza a la perfección con un paisaje flanqueado por las montañas de la Sierra Madre Occidental y la playa más bonita de Vallarta.
Sus huéspedes gozan de la frescura de su gran palapa en el lobby; una hermosa cascada; bellas habitaciones decoradas de forma diferente, cómodas y funcionales suites. Todo esto en un ambiente que favorece el descanso y la relajación.
- Fiestas y Eventosfiestasyeventosperu.com
Empresa peruana que nace en el 2012, después de brindar por varios años, servicio a diferentes proveedores encargados de realizar eventos.
A la sombra de estas empresas cumplimos siempre con nuestro objetivo, que es llevar al más alto nivel y satisfacer totalmente al cliente final, llegando a crear una atmosfera de ensueño y dejando a los invitados un feliz recuerdo de la fiesta o evento.
Los cocineros y Cheff , antes de pertenecer a nuestro Staff pasan por un control muy delicado en la preparación de los alimentos.
Asimismo nuestro personal de Bar, cuenta con estudios en los mejores institutos del Peru.
Contamos con 150 asociados entre DJS =Discjockey, VJS = VideoJockey, KDJ = Karaoke Dj cada uno un profesional hecho en base a mucha experiencia con el público.
Nuestro personal de servicio (mozos) capacitados para trabajar y brindar un trato amable a cada uno de los invitados.
Nuestros Equipos de Sonido son de Última generación, y de marcas conocidas y reconocidas por profesionales de todo el mundo.
Las luces crean un ambiente mágico ya sean tipo discoteca o para decoración.
Las estructuras y toldo son diseñadas de acuerdo al área donde será el evento, presentando una maqueta antes de ser aprobado el proyecto de una fiesta o reunión.
Las mesas y sillas, son de metal y tienen manteles de muy lindos colores (escogidos anticipadamente por el contratante)
El tabladillo o pista de baile va de acuerdo a la cantidad de invitados asi como el color y diseño del mismo.
La hora Loca en esta parte contamos con profesionales (Grupo Teatral) que hacen de este momento un ambiente festivo, donde todos los invitados salen a bailar y disfrutan durante esta hora de todos los ritmos más bailables de acuerdo a la temática del evento.
- Fiesta Toyfiestatoy.com
Fiesta soft teddy bears and stuffed animal friends have delighted children of all ages for over 35 years.
Fiesta offers stuffed teddy bears, jungle animals, plush zoo animals, sea life plush, wildlife, stuffed cats and dogs, stuffed horses, barnyard, birds, reptiles, stuffed polar bears, penguins, animal plush backpacks, purses, puppets, stick ponies, ride-ons, Plus....
Custom Plush designs, Amusement Arcade stuffed animals, Halloween, Christmas, Valentine and Easter stuffed animals and home decor.
- Fiets!fiets.be
Fiets! - Hans Struijk Fietsen is een jong, dynamisch en snelgroeiend bedrijf. Opgericht in 2010 is het in snel tempo uitgegroeid tot een keten met momenteel 13 winkels in België (merknaam Fiets!) en 15 winkels in Nederland (merknaam Hans Struijk Fietsen – acquisitie mei 2015). Het bedrijf telt meer dan 200 medewerkers. Fiets! - Hans Struijk fietsen is marktleider in de verkoop van merkfietsen, fietskleding en accessoires. Het format onderscheidt zich door haar hoogwaardige aanbod, de leuke winkel-look en de expertise van haar teams. Fiets! - Hans Struijk fietsen is verdeler van tal van topmerken zoals Trek, Flyer, Stromer, Koga, Brompton, Cube, Gazelle ed.
Fiets! - Hans Struijk Fietsen biedt alles wat het hart van de recreatieve, sportieve en stadsfietser begeert. Kwaliteitsproducten en top-service, aangeboden in een aantrekkelijke winkelomgeving.
Ons assortiment omvat het beste en het leukste van de fietswereld. We hebben de gevestigde waarden en toppers in huis. Maar we zijn ook constant op zoek naar nuttige of hippe nieuwigheden in binnen- en buitenland die het fietsersleven comfortabeler, spannender of gewoon leuker maken.
Voor betrouwbaar en snel onderhoud of herstelling van je fiets kan je eveneens bij ons terecht.
- Fietsersbondfietsersbond.nl
Check de site en je zult versteld staan van de vele leden en taken van de Fietsersbond. www.fietsersbond.nl
- vrijwilligerswerkfietsmarkenaa.nl
- Fietz GmbHfietz.de
Fietz GmbH is a company based out of Germany.
- FIFfif.asso.fr
FIF is a company based out of France.
- FIFAfifa.org
The Fédération Internationale de Football Association (FIFA) is an association governed by Swiss law founded in 1904 and based in Zurich. It has 211 member associations.
FIFA's primary objective is 'to improve the game of football constantly and promote it globally in the light of its unifying, educational, cultural and humanitarian values, particularly through youth and development programmes'.
'Organising inspiring tournaments' and 'Building a better future for all through football' are the second and third pillars of FIFA's mission.
You can learn more, here: http://www.fifa.com/about-fifa/who-we-are/explore-fifa.html
- Fife Collegefife.ac.uk
Welcome to Fife College!
We deliver over 1,000 courses from introductory level to degree and postgraduate study offering a wide variety of subjects from engineering and renewables through to hairdressing and beauty and everything in between. We also have close ties with national universities with whom we offer a great range of degree courses. Currently, there are approximately 22,000 learners that choose to study with Fife College.
Our world class Fife College Business Training and Development, offering a wide range of courses – both scheduled and bespoke – is perfect for your business needs. Visit http://business.fife.ac.uk for more information.
We are proud to cover the whole of Fife with campuses and learning centres located across the Kingdom, welcoming local, national and international students. Our main campuses can be found in Dunfermline, Kirkcaldy, Rosyth, Glenrothes and Leven.
We are always at the forefront with new courses and services for our customers, but always with an eye to our heritage and the quality this brings. Together with our other business units we consistently demonstrate cutting edge practice in social inclusion, workforce development, e-learning, services to businesses and the local community.
For more information and to see a full list of our courses, please visit www.fife.ac.uk.
- Fife Councilfife.gov.uk
Fife Council is committed to making the Kingdom the best place to do business.
Fife Council is the third largest local authority in Scotland. We employ approximately 20,000 people who provide 900 different services to over 366,900 people. The services we provide range from education, social work, housing, and community services to transportation, looking after the environment and developing the economy.
See our jobs on https://www.myjobscotland.gov.uk/councils/fife-council/jobs
Find out more about Fife Council's services for business http://fifedirect.org.uk/business
- Fife & Cesta, PLCfifecestalaw.com
At Fife & Cesta, we provide High-quality, low-cost bankruptcy representation to help individuals and families get out of debt. We ARE a debt relief agency. We help people file for relief under the Bankruptcy Code. Your family and your financial future is too important not to explore all of your options.
CALL NOW for a free, no pressure consultation (480) 850-6541
- Housewife/childminder & rabbit rescuer!fiferabbitrescue.co.uk
- Fife Public Schoolsfifeschools.com
Fife Public Schools is a district serving approximately 3500 students. We are located between Tacoma, Federal Way, and Puyallup. Fife is a great place to learn and work.
The core business of the Fife School District is to produce work that engages students:
» Work that is so compelling that students persist when they experience difficulties.
» Work that is so challenging that students have a sense of accomplishment and satisfaction when they accomplish the tasks assigned.
- FIFGROUPfifgroup.astra.co.id
Member of Astra International Financial Services Division.
VISI
Menjadi Pemimpin Industri yang Dikagumi Secara Nasional
MISI
Membawa Kehidupan yang Lebih Baik untuk Masyarakat
FIFGROUP adalah grup manajemen dari beberapa perusahaan yang memiliki unit bisnis yang berbeda-beda. FIFGROUP saat ini menaungi PT Federal International Finance dan PT Astra Multi Finance. FIFGROUP bergerak di bisnis layanan pembiayaan dengan nama merek berikut:
1. FIFASTRA
Jasa layanan pembiayaan sepeda motor Honda. Baik motor baru maupun seken berkualitas.
2. SPEKTRA
Jasa layanan pembiayaan multiproduk, mulai dari elektronik, perabot rumah tangga, peralatan komputer, furnitur, sepeda sampai dengan traktor tangan.
Jasa layanan pembiayaan ini meliputi metode pembiayaan konvensional maupun syariah.
FIFGROUP hadir untuk mengakomodir keanekaragaman kebutuhan masyarakat Indonesia dengan senantiasa berpegang pada prinsip inovasi dan kreativitas. ‘Mengubah tantangan menjadi peluang' adalah landasan pemikiran yang membuat FIFGROUP terus berkembang.
- Fifo Capital New Zealandfifocapital.co.nz
Flexible, fast business finance for cash flow gaps and growth.
At Fifo Capital we believe in partnership. We partner for the success of your business by offering finance solutions that will allow you to realise your potential. Whether you're looking for an alternative to a bank, or you're just seeking a company that will focus on your needs not their products: we can help.
We specialise in solutions that will boost your cash flow to allow you to manage day-to-day costs or enter that next phase of business growth. Getting access to cash isn't always easy, but our low-stress approach means that you can rely on dealing with one member of our team who will be there when you need them and can turn around your requirements fast.
Fifo Capital provides a wide range of high quality products that have been designed with your needs in mind. Whether you are looking for a short term business loan; a stock loan; invoice finance or a payment plan to take to make breaking down payments easy for your customers: we've got the right product for you.
We recognise that every business that we deal with is different and that's why we are. Contact us today to find out more about our cash flow solutions.
- FIFProfifpro.org
FIFPro is the worldwide representative organization for all professional players; more than 50,000 footballers in total. FIFPro exists since 1965 and currently has 46 members, 9 candidate members and 9 observers. On this page the World Players' Union portraits itself; its idea, its history and its organisation.
- First Investors Financial Servicesfifsg.com
First Investors Financial Services Inc., through its wholly-owned subsidiaries ("First Investors") is an automobile finance company founded in 1988 to serve the special finance needs of automobile dealers and consumers. First Investors has created a unique business model that encompasses indirect and direct lending as well as portfolio acquisitions and third-party servicing. This multi-channel approach provides asset and revenue diversification as well as a deep understanding of the auto financing needs of both dealers and customers.
- Fifth Dimension Research and Consultingfifth-dimension.com.au
5D is a boutique market research and consulting agency that specialises in understanding what motivates customers' behaviour and decision making.
We...
• are highly experienced research, marketing, psychology and management consulting experts
• have both consultancy and direct business experience
• are united by a common drive to be the best at what we do
Like most market research companies we offer a wide range of qualitative and quantitative research methodologies, however what makes us unique and highly successful is how we approach market research projects and the depth of insight and understanding we provide.
Key reasons why companies prefer to partner with us, we...
• quickly understand business problems and think on our feet
• think through the business issues, challenge hypotheses and present well considered approaches
• are fast to respond to requests and ensure project timelines are met
• provide detailed recommendations on turning insights into strategic business advantage
- Fifth Avenue Collectionfifthavenuecollection.com
Fifth Avenue Collection is a direct sales company selling high quality, fine fashion jewellery. We offer women a career that gives them personal and financial rewards outside the home without compromising their commitment to family life. Give me a call if you are looking for a home based business or need an extra income at 780-416-5068.
- The Fifth Businessfifthbusiness.com
We're in the business of ‘engaging people'. It sounds simple, but we know that how you communicate with your workforce makes or breaks any kind of business endeavour. We believe that by engaging people to embrace change, we can help you realise your organisation's untapped potential.
Inspiring, training, stimulating and supporting people is what we've been doing for over 20 years, working across all kinds of business sectors and project types. As a fully-integrated change management consultancy, our expertise, experience, creative flair and passion is at your disposal. Our joined-up approach ensures a cost-effective, efficient and coherent delivery.
Concise communications, cutting-edge SharePoint solutions, inspiring e-learning and creative design are just some of the skills we have to offer. Creating the right mix of disciplines means we can tailor our approach to meet your needs and budget.
Why not get in touch to hear more about how we can support you.
- Fifth Group Restaurantsfifthgroup.com
FIFTH GROUP RESTAURANTS - FOR ALL FIVE SENSES
We understand that an enjoyable dining experience is as much about satisfying your mood as it is your hunger. That's why our unique dining concepts have been Atlanta's progressive, yet classic, choice since 1993; we offer our guests the opportunity to experience joy through food and drink in a uniquely different way at each of our restaurants.
South City Kitchen Midtown, South City Kitchen Vinings, La Tavola, The Original El Taco, Ecco, Alma Cocina, Lure and our catering division, Bold American Events - all share a passion for providing food for every mood and tastes for every occasion.
- fifthplay nvfifthplay.com
The rapid growth of broadband internet creates many opportunities for companies to deliver exciting new products and services at home. Therefore, fifthplay has developed an innovative IP-based 'e-services' platform and customer portal. We connect our fifthplay Gateway residential gateway to a wide range of in-home sensors, appliances and devices. We capture end-user interactions and transactions in our back-end fifthplay Core service platform. That way, we can deliver new and innovative services to consumers and small businesses, via the internet.
fifthplay provides service partners with an integrated 'e-services' platform that allows consumers to remotely monitor and control sensors, monitoring devices and electrical appliances in their home or business, through a simple web interface. We enable our partners to deliver innovative in-home services to the consumer and small business market, enabling new revenue streams and increased customer loyalty.
- Fifth Street Asset Managementfifthstreetfinance.com
Prior to the closing of its asset sale to Oaktree, Fifth Street Asset Management Inc. (NASDAQ:FSAM) was a nationally recognized credit-focused asset manager. The Fifth Street platform provided innovative and customized financing solutions to small and mid-sized businesses across the capital structure through complementary investment vehicles and co-investment capabilities. With a nearly 20-year track record focused on disciplined credit investing across multiple economic cycles, Fifth Street was led by a seasoned management team that issued billions of dollars in public equity, private capital and public debt securities. Fifth Street's national origination strategy, proven track record and established platform have allowed the firm to surpass $10 billion of loan commitments since inception.
- 55 | fifty-fivefifty-five.com
fifty-five, the data company for brandtech success
fifty-five helps brands leverage their data to increase marketing, advertising, and sales effectiveness. We help businesses collect, enrich, and activate their data to find new customers, foster engagement, increase conversion, and drive sales across online and offline channels. We work with our clients to achieve these goals using a combination of consulting, software, and managed services. Co-founded by former Google executives, fifty-five has offices in Paris, London, Hong Kong, Shanghai and New York.
We're hiring! Please visit our website to have a look at our job openings
www.fifty-five.jobs
- Fifty Five Bar & Loungefiftyfivebar.co.uk
We currently have two bars and are looking to expand in the near future.
Our flagship bar is in NW1:
Located in the heart of Camden but set away from the jostling crowds of shoppers, we know Fifty-Five is a rare gem. Set over two spacious floors, Fifty-Five fuses the best in premium cocktails with an unpretentious, buzzing atmosphere every night of the week.
Its sister bar is situated in Clapham High Street, providing an all day offering and closing late 7 nights a week. We're bringing a slice of Camden south of the river.
- FiftyForwardfiftyforward.org
Established in 1956, FiftyForward supports, champions and enhances life for those 50 and older. As a nonprofit operating seven lifelong learning centers –- two in Williamson and five in Davidson County -– FiftyForward offers educational, health and wellness, arts and volunteer programs to engage older adults. FiftyForward also provides comprehensive supportive services and access to resources including FiftyForward Adult Day Services, FiftyForward Meals on Wheels as well as the FiftyForward Care Team offering care assessment and services for older adults. FiftyForward Travel offers adventures (regional and international) and the Senior Center for the Arts and The Larry Keeton Theatre, a subsidiary of FiftyForward, feature performing arts for all ages. Get social with us - friend us on Facebook, follow us on Twitter and Instagram. Learn more about FiftyForward resources and volunteer opportunities by visiting: www.fiftyforward.org.
- Fifty Plus Relocation Limitedfiftyplusrelocation.com
Move Manager - Home to Home Relocation Services for the Over 50s (& over 45s) Anywhere in the U.K. For mature adults and their families, we offer residential downsizing, moving and relocating.
We organize, action plan, research and prioritise the following:- de-clutter, home stage for house sale presentation to assist in the sale of your home, facilitate and liaise with Family, Solicitors, Estate Agents, Retirement Residences, Auctioneers, Removal Companies, Interior and Exterior Designers, arrange/coordinate pack and unpack nationwide, change addresses, change over utilities and do utilility induction, arrange technology, curtains and carpets, all on behalf of our clients. We welcome our clients into their new home, kitchen unpacked, hot meal, bed made, kettle on ready to settle in, essential shopping delivered whatever is needed.We do as little or as much as our clients require. Our fees are from as little as £200 to our Fixed Fee of £1950 for our Complete Service please see our Flyer on our Download on our website www.fiftyplusrelocation.com We offer constancy and co-ordination through the myriad of processes, helping our clients every step of the way. Estate Sales managed too. Insured and Members of the National Association of Move Managers (NASMM). Available on the phone 7 days a week
- FiftyTwoWordsfiftytwowords.com
FiftyTwoWords are dedicated to the meaning behind words. It is a series of themed events which focus on delivery of a unique experience, through the art of storytelling. FiftyTwoWords is a celebration of human experiences. At the centre of every performance are words and every word tells a different story. Share yours.
- Fifty Wordsfiftywords.co.uk
Digital Transformation & Content Strategy - Chief Digital Officer
A thought leader in the content discipline and digital practitioner with focus on customer experience, I am a leader in the field of content strategy with a background in global organisations, including several years at PayPal, as Director International Content.
During the last few years I have enjoyed working on a range of initiatives:
◾Digital transformation: as an interim director
◾Conference speaker at Content Strategy Applied 2017
◾Working with a digital agency to develop a compelling new product based on SEO keyword research
◾Contributing writer: on a range of topics including the practicalities of global content management
◾Beta testing: advising on site functionality requirements for a global CMS product
Experienced at helping companies make the move into digital, I am focused on project management, enabling organisations to deliver customer-centric experiences to global markets in highly-regulated environments.
- Fig.comfig.com
Fig is mobile startup focused on personal wellbeing. We aspire to redefine wellness and make it reachable for most Americans.
Advertisers try to convince us that we're not thin or muscular enough. They appeal to our insecurities to sell us stuff. But deep down, most of us realize that wellness isn't superficial (a size zero dress or bulging biceps). Wellness is a journey of holistic transformation and our capacity for fulfilling our life missions.
We started Fig to lower barriers (time, complexity, etc.) to wellness and make it easier for loved ones to encourage one another forward. Our team is laboring to create a future where most Americans achieve radically higher wellness – a future where we experience more richness in our most important relationships, more physical vitality, much less disease, and more spiritual and emotional fulfillment.
Our team at Fig is just getting started. We hope you'll join us. Together, let's enhance human flourishing.
- FIG - International Federation of Surveyorsfig.net
FIG is an international, non-government organisation whose purpose is to support international collaboration for the progress of surveying in all fields and applications. FIG is the premier international organization representing the interests of surveyors worldwide. It is a federation of the national member associations and covers the whole range of professional fields within the global surveying community. It is a UN-recognized non-government organization (NGO), representing more than 100 countries throughout the world.
- Figfig.vc
Fig provides a pragmatic new approach to supporting and investing in high-growth early-stage companies.
Fig brings together exciting early-stage companies and experienced, value-added investors.
Its current portfolio includes fitness equipment manufacturers, neuroscience attention analytics, Software as a Service (SaaS), food & beverage companies and medical devices.
- FIG & OLIVEfigandolive.com
FIG & OLIVE is about passion for the best olive oils, flavors and cuisine from the Riviera & Coastal regions of the South of France, Italy and Spain. Our large variety of extra virgin olive oils was selected to be paired with each dish and to be offered for tasting at the beginning of each meal. With fresh, seasonal ingredients and simple preparation, our cuisine exudes the genuine taste of food, from a ripe heirloom tomato, a leaf of aromatic basil, to a fresh grilled fish finished with lemon, rosemary, thyme and olive oil-simplicity, healthiness and refined flavors at their best.
Mougins, France has been the inspiration for FIG & OLIVE. Our cuisine is based on genuine ingredients and a respect of flavors. Mougins is also referred to as the birthplace of the 'Cuisine of the Sun.' FIG & OLIVE'S elegant and warm design with limestone stucco walls, terra-cotta colored ceiling, and green rosemary and olive trees exude the essence of the Mediterranean.
FIG & OLIVE is actively seeking exceptional and highly qualified candidates to join our growing team in the following locations Chicago, IL, Newport Beach, CA, New York City, Westchester, NY, West Hollywood, CA, and Washington D.C. We firmly believe that in order to create a rewarding experience for our guests, we must select individuals willing to deliver the finest service imaginable.
To create a successful hospitality team, we seek individuals who can personally follow the five key points of our value system: Enthusiasm, Desire, Integrity, Excellence, and Hospitality. At FIG & OLIVE, we pride ourselves on developing motivated and passionate individuals in the areas of restaurant front and back of the house, finance, human resources, sales and marketing and corporate management positions. If our brand and culture aligns with your career aspirations, we invite you to search our current exciting job opportunities.
- FIGAP S DE RL DE CVfigap.com
FIGAP es un evento bi-anual en el cual se exhiben todo tipo de porductos de diferentes categorias del sector, asi como ciclo de conferencias y cursos de la escuela de porduccion, y hasta la fecha se han realizado 4 ediciones con mucho éxito; en esta última edición fueron 10,500 Mts² de exhibición, con empresas expositoras provenientes de diversos países como: Argentina, Canadá, China, Dinamarca, España, Estados Unidos, Holanda, Italia y México; se recibieron 4800 visitantes, acreditados, de todo México Estados Unidos, Centro y Sudamérica.
FIGAP cuenta con la alianza comercial de VNU Exhibitions Co., (VIV) empresa holandés especializada en la organización de ferias y exposiciones en Europa y Asia, ahora también FIGAP/VIV América Latina. (www.viv. net ).
CATEGORIAS QUE PARTICIPAN EN FIGAP:
Fabricantes de maquinaria para la industria de los alimentos balanceados, equipos agropecuarios, salud animal, genética, nutrición, software pecuarios, distribuidores internacionales de silos metálicos para el almacenamiento de granos e ingredientes, compradores y comercializadores de granos y semillas, fabricantes de alimentos balanceados y forrajes, fabricantes de alimento para mascotas (Pet-Food), empresas acuícolas, distribuidores de ingredientes y aditivos, empresas de FFCC y transportes de carga, agentes aduanales, equipos para rastros, entre otros.
- FIGARET PARISfigaret.com
Figaret Paris est la référence française de la chemise depuis 1968. Durant toutes ces années, dédiées à l'art de l'élégance à la française, la maison Figaret a développé un savoir-faire unique. La tradition des fabrications, la recherche de matières exceptionnelles et de coupes parfaites, le soin apporté aux détails et finitions, tout converge vers un seul but : satisfaire au besoin d'excellence des hommes et femmes qui font confiance à Figaret.
- Figaro Classifiedsfigarocms.fr
FIGARO CLASSIFIEDS, filiale du GROUPE FIGARO, est une des sociétés Internet les plus importantes en France, avec 60 MEUR de C.A., 350 collaborateurs et 3,5 millions de visiteurs uniques dédupliqués par mois sur l'ensemble de nos sites.
Notre raison d'être est d'apporter des réponses à 3 préoccupations essentielles des Français : l'Emploi, la Formation et l'Immobilier.
Notre ambition est de proposer aux internautes/mobinautes et aux professionnels ' le meilleur des médias et des solutions d'annonces classées '.
Nos marques-phares (CADREMPLOI, KELJOB, LE FIGARO ETUDIANT, EXPLORIMMO, PROPRIETES LE FIGARO...) allient puissance, affinité CSP+ et influence, comme autant de facteurs de différenciation par rapport à nos concurrents.
- Figaro Mediasfigaromedias.fr
Publicité et Partenariats au sein du pôle Culture de la régie du groupe Figaro.
Transversalité entre les titres print et web.
- Figeac Aerofigeac-aero.com
Figeac Aero Group is a world class aerospace company specialized in the machining of structural parts, engine and precision parts in light alloys and hard metals. Figeac Aero is able to machine from small fitting to the large 26 meters long panel. The Group produce sub-assemblies too.
The company realizes complete services like design, sourcing of material & component, machining, forming activities, sheet metal work, dimensional inspection, shoot peening, surface treatment, heat treatment, assembly, final inspection and presents major qualifications and certifications as ISO 9001 / EN 9100 / NADCAP.
The group is present in France (Figeac, Picardie, St-Nazaire, Brive-La-Gaillarde, Decazeville, Auxerre, Aulnat), in USA (Wichita), in Tunisia (Fouchana), in Morocco (Casablanca) and in Mexico (Hermosillo) in order to ensure a presence close to its customers for machining and sub-assembly activities. The Group count 3 independent companies in France : "Mecabrive Industries", 'SN Auvergne Aeronautique' and "MTI".
With more than 3 000 employees in the world and a turnover of 325 Millions € (31st March 2017), the goal of the group is to reach a turnover of 650 Millions € minimum at the 31st March 2020.
- Figensoftfigensoft.com
1997 yılında, mobil teknolojiler konusunda hizmet vermek üzere kurulan Figensoft, 2002 yılında Turkcell, 2008 yılında ise Avea ve Vodafone ile katma değerli iş ortaklığı anlaşması imzalamıştır.
Figensoft, bugün, Türkiye'deki üç büyük operatörün katma değerli hizmetlerini ve mobil pazarlama çözümlerini, kurumsal müşterilerine sunmaktadır.
Mobil uygulamalar alanında da sektörde birçok yeniliğe imza atan Figensoft'un bünyesindeki deneyimli yazılım ekibi, kurumların verimliliğini artırmayı hedefleyen mobil uygulamalar geliştirmektedir.
17 yılı aşkın bir süredir sahip olduğu birikimi ile önemli başarılara imza atan Figensoft, 2012 yılında bu birikimini dış pazarlarda da değerlendirmeye karar vererek, KKTC, Dubai, Azerbaycan ve Gürcistan'da faaliyet göstermeye başlamıştır.
Sektöre adım attığı ilk günden beri, açıklık, dürüstlük, güven ve müşteri odaklılık ilkelerinin ön planda olduğu yönetim yaklaşımını esas alan Figensoft, değerleri ile yükselen bir şirket olmayı hedeflemektedir.
- FİGES A.Ş.figes.com.tr
FİGES A.Ş. 1990 yılında kurulmuş bir mühendislik firmasıdır. Tasarım, analiz ve test mühendislerinden oluşan uzman kadrosuyla Savunma, Havacılık ve Otomotiv sektöründe konsept tasarımından prototip imalatına kadar bir alanda anahtar-teslim proje hizmetleri vermektedir.
FİGES'in ofisleri İstanbul-Tuzla Tersaneler Bölgesinde, Bursa Uludağ Üniversitesi Ulutek Teknoloji Geliştirme Bölgesi'nde, Ankara'da ODTÜ & OSTİM Teknokent'te, ve İzmir Tepekule İş Merkezi'nde yer almaktadır.
Türkiye'de son yıllarda sürekli artmakta olan Savunma Sanayi projelerindeki ihtiyaç nedeniyle FİGES, Tesis Güvenlik ve NATO-Gizli yetki belgelerini almak için gerekli yatırımları yapmış ve Savunma Bakanlığı'ndan onay almıştır. FİGES ISO 9001-2008 belgesine sahiptir.
FİGES, çeşitli disiplinlerde uzmanlaşmış kalifiye ve esnek yapıdaki yaklaşık 60 kişilik mühendislik kadrosuyla çeşitli alanlarda ve platformlarda tasarım, analiz ve tasarım optimizasyonu ile sertifikasyon süreçlerinde gerekli olan ileri mühendislik hesaplamalarını gerçekleştirmektedir. Şirket ayrıca, ileri mühendislik faaliyetlerini, tasarım ve sayısal benzetim ile mekatronik olmak üzere iki alanda yürütmekte olup, bu iki alanın yarattığı sinerji ile müşterilerine entegre çözümler sunmaktadır.
Dünyanın önde gelen sonlu elemanlar yazılımı ANSYS Multiphysics'in ve MATLAB & Simulink'in Türkiye'deki temsilcisi olup, bu yazılımlar ile ilgili pazarlama, satış, eğitim ve teknik destek hizmetleri vermektedir.
- FightCon Fighting Fitfight-con.com
FightCon Fighting Fit is a company based out of United Kingdom.
- Philadelphia FIGHTfight.org
Philadelphia FIGHT is a comprehensive AIDS Service Organization providing state of the art, culturally competent HIV primary care, consumer education, advocacy, social services, outreach to people living with HIV and to those who are at high risk, and access to the most advanced clinical research. Our goal is to end the AIDS epidemic within the lifetime of those currently living with HIV.
- Foundation Fighting Blindnessfightblindness.org
The urgent mission of the Foundation Fighting Blindness, Inc. is to drive the research that will provide preventions, treatments and cures for people affected by retinitis pigmentosa (RP), macular degeneration, Usher syndrome, and the entire spectrum of retinal degenerative diseases.
- Fight Campfightcamp.org
Fight Camp is a company based out of City Campus 70 Cowcaddens Road , GLASGOW, United Kingdom.
- Fight For Families Fellowshipfightforfamiliesfellowship.org
Fight For Families Fellowship is an Airlines/Aviation company located in 1016 Thames St, Wilmington, Delaware, United States.
- fightgravityfilmsfightgravityfilms.co.uk
We're a dynamic multi-platform film production agency based in Soho, London. We specialise in CONTENT STRATEGY, PRE-PRODUCTION, PRODUCTION, POST-PRODUCTION, COLOUR GRADING, MUSIC COMPOSITION, CAMERA OPERATION.
Our team has produced outstanding video campaigns for clients including BMW, Red Bull, Sony, Hamilton Watches, Paco Rabanne, New Balance, Speedo and Renault.
We do this through the use of innovative-filming techniques, cutting-edge tech and unrivalled creativity. And we infuse everything we do with bags of emotion, enthusiasm and energy because, for us, the final product has to reflect these values.
If you're looking for a team to conceive, produce and edit inspiring video content that significantly increases your viewer engagement, email or call us.
Or, if you like to do things in a more face-to-face way, drop in to see us at our office – we're based in the heart of Soho in London, which means we're easy walking distance from Leicester Square, Piccadilly Circus, Oxford Circus and Tottenham Court Road tube stations.
fightgravityfilms, 51-52 Frith Street, Soho, London W1D 4SH
- America's Second Harvest of the Big Bendfightinghunger.org
Our mission is to feed the hungry in the Big Bend through our network of partner agencies, and to educate and engage the community in the fight against hunger.
Established in 1982 as the Food Bank of Tallahassee, we began by picking up prepared and perishable foods at local restaurants and grocery stores ("food rescue"). We continue that today through our Second Helpings Program, but have continued to expand our services as we work to feed the hungry.
In 1986 we joined America's Second Harvest – the Nation's Food Bank Network, now called Feeding America, which enabled us to obtain and distribute non-perishable donations. Feeding America is the network of 206 food banks in the country that each have a defined service area. Feeding America solicits donations from national manufacturers and companies, such as Kellogg's, ConAgra, and Kraft, but also works on national public awareness and advocacy issues.
Our defined service area includes the ten counties of the Big Bend, including Leon, Jefferson, Taylor, Wakulla, Gadsden, Jackson, Liberty, Calhoun, Franklin and Gulf Counties. We deliver to our partner agencies in each of these counties to ensure they have the food needed to distribute and serve their clients.
- Fight Town Storefighttownstore.com
Fight Town is a provider of fighting gear and martial arts equipment. Everything you need for Boxing, Muay Thai, MMA, K1 and Kickboxing is now available on our official website: www.fighttownstore.com
Fight Town Sore is for all fighting sports and martial arts fans. News, product details, guides related to fighting gear and martial arts equipment are posted on this page. Take a look and leave a comment!
We are also on the following social media platforms.
Twitter: twitter.com/fighttownstore
Facebook: www.facebook.com/FightTownStore/
Pinterest: it.pinterest.com/fighttownstore/
Instagram: instagram.com/fight_town
YouTube: /www.youtube.com/Fighttownstore
- Hotel Theater Figifigi.nl
Hotel Theater Figi is een uitstekende locatie voor zakelijke evenementen nabij de bosrijke omgeving van de Utrechtse Heuvelrug:
- Vier congreszalen: 550, 190, 170 en 130 personen
- Centrale ligging op 20 minuten rijden van Utrecht
- Boardrooms en banquetzalen: 8 tot 300 personen
- Audio-visuele techniek en technici voor bedrijfspresentaties
- Parkeergarage met 270 plaatsen
- Viersterrenhotel: 97 hotelkamers
Voor meer informatie: bel 030 692 75 50 of mail naar [email protected]
- Figi's Companies, Inc.figis.com
Since 1944, Figi's® has delivered the finest quality gift baskets to discerning customers across America. From the beginning, we were determined to deliver satisfaction to every home. You'll discover that same determination to please you in everything we do.
Browse our collection of gourmet food gifts and you'll find the best of the Heartland, delicious chocolates and snacks, fabulous smokehouse meats - and just wait until you taste our House Recipe Cheese Spreads made from quality Wisconsin cheese! We specialize in exquisite holiday fare, so of course you'll find the best in bakery gifts, chocolates, nuts, sweets and snacks. Plus, we offer special gift assortments, collectible treasures, exclusive and personalized items.
Figi's® Gallery makes your life easier by providing fun and functional items of exceptional value for you, your home, and your friends and family. You will find Figi's® Gallery is easy to shop and offers home decor, bedding, housewares, jewelry, garden accents, apparel, collectibles, gifts, and more.
Whatever the occasion, Figi's® has the perfect gift - and it's just a click or a phone call away!
We'll package it carefully and send it out to arrive in perfect time, anywhere in the USA!
- Istituto Figlie di San Camillofigliesancamillo.it
Ospedali e Case di Cura
- Figlofiglo.com
Sinds 1996 ondersteunt Figlo financieel adviseurs, banken en verzekeraars bij financiële advies- en informatieprocessen. De Figlo producten zijn ontworpen om financiële zaken inzichtelijk te maken en laagdrempelige toegang te bieden tot deze belangrijke informatie. Het uitgangspunt van Figlo's producten is dat ze zowel de financieel adviseur als de klant voordelen bieden.
Voorbeelden van producten waar de Figlo technologie achter zit, zijn de Online Kasboekjes van ABN Amro, Rabobank en SNS, het Financieel Plan van Knab en alle Hypotheekshop adviesdiensten. Daarnaast werkt het grootste deel van de intermediaire markt, financieel planners en accountants met het Figlo Platform.
Met ruim 60 medewerkers zijn we gevestigd in Capelle aan den IJssel en Zwolle. Figlo is onderdeel van het Amerikaanse bedrijf Advicent Solutions..
- Financial Independence Groupfigmarketing.com
Welcome to Financial Independence Group, Inc. We're and industry leader working with the most competitive and financially stable insurance companies in the industry, specializing in annuities, long-term care, and life insurance products.
Since 1976, we have been representing some of the most competitive and financially stable insurance companies in the industry; building lifelong partnerships along the way.
At Financial Independence Group, Inc., an advisor has a team of specialized marketers to contact, as well as a support staff available to answer any question and to follow up on the advisor's business.
Are you ready to set yourself apart from the competition and take the next step in financial leadership? Contact us today, and let us show you what it truly means to become the Advisor of Tomorrow.
- FIGmd, Inc.figmd.com
FIGmd offers software products and services that help health care organizations measure and improve clinical quality. FIGmd is a leading clinical data registry solutions and management services provider, operating many of the largest medical society registries.
With several years of experience, FIGmd has pioneered the technology behind seamless, automated, high fidelity data abstraction from EHRs, PM systems and other components of Health IT systems to feed into the clinical data registries.
- figo GmbHfigo.io
The seemingly inseparable connection of banks and "banking" is breaking up! In its place, figo has become Europe's first banking service provider.
With its business model, the Hamburg-based B2B company has opened the doors to the banks and is a company unlikely most any other in this new open banking world. Data from 3,200 financial sources such as bank accounts, credit cards, deposits, PayPal and FinTech companies can be reached via figo, with more to come. The Payment Services Directive 2 (PSD2) itself outlines a successful concept for the infrastructure provider. One aspect of the new EU directive is the Access to Account (XS2A), which requires banks to make bank data available to so-called third parties. With its multifunctional platform technology, figo provides technical solutions for complying with XS2A, meaning banks do not have to develop this interface themselves. The extensive management functions of this tool include all regulatory requirements. Banks can also use the figo 'Banking as a Service' platform to create their own innovative products themselves.
The combination of technology, regulation and community determines the strategic orientation of the company, putting figo on the way to becoming one of the first regulated FinTech companies within the PSD2. The objective is to assume the function of regulated account information and payment service provider for companies that are not regulated and to be a reliable outsourcing partner for those that are.
As the foundation for the banking of the future, figo is positioned as a reliable solution provider for banks, FinTechs, e-commerce and software houses of all sizes. Compliance, data processing, full-service and business intelligence are key added values, with figo currently working with almost 40 experts every day.
Contact form at https://www.figo.io/en/contact/
Imprint: https://www.figo.io/en/imprint/
- Francuski Instytut Gospodarki Polskafigpolska.pl
Francuski Instytut Gospodarki Polska jest firmą ekspercką, której misją jest:
„Wspierać najwyższą kadrę zarządzającą w osiąganiu przełomowych wyników poprzez edukację, doradztwo oraz nadzór nad realizacją projektów biznesowych w oparciu o „najlepsze praktyki" i doświadczenia."
Od 1992 roku, prowadzimy dwie komplementarne działalności: organizacji seminariów i warsztatów doradczych dedykowanych dla najwyższej kadry zarządzającej (FIG SEMINARIA) oraz doradztwa biznesowego (FIG CONSULTING).
Specjalizujemy się w doradztwie strategicznym, finansowym i marketingowym. Jesteśmy liderem na rynku polskim w zakresie budowy i wdrożeń strategii w oparciu o metodyki Balanced Scorecard i EVA.
Balanced Scorecard pozwala przełożyć strategię przedsiębiorstwa na działania operacyjne i skoncentrować jego wysiłki na wybranych priorytetach. Ogromne korzyści z wykorzystania tego systemu, sprawiają, iż Balanced Scorecard staje się standardem zarządzania strategią i działaniami operacyjnymi w nowoczesnych przedsiębiorstwach.
Realizujemy projekty szkoleniowe i doradcze zgodnie z wdrożonym systemem zarządzania jakością ISO 9001-2000.
Dane teleadresowe i rejestrowe
Francuski Instytut Gospodarki Polska Sp. z o.o.
ul. Filtrowa 75/5, 02-032 Warszawa,
tel. (22) 823 42 83, fax. (22) 823 99 13
e-mail: [email protected]
www.figpolska.pl
- Figueiredo Ferraz Consultoria e Engenharia de Projeto SAfigueiredoferraz.com.br
O desenvolvimento da Figueiredo Ferraz confunde-se com o da Engenharia no Brasil. A inovação na solução de desafios técnicos tornou-se sua marca registrada. Essa ousadia de criar, baseada na permanente interação com Universidades e Centros de Pesquisa, permitiu prover contínuo aperfeiçoamento e atualização a seus colaboradores. Essa interação confere à Empresa a valorização do elemento humano, permite absorver e propagar novas tecnologias e mantém a Figueiredo Ferraz na vanguarda tecnológica.
Há mais de 60 anos a marca Figueiredo Ferraz está presente em grandes realizações da engenharia nacional. Sua postura pioneira introduziu e desenvolveu no País novas tecnologias que viabilizaram empreendimentos que vêm contribuindo para o desenvolvimento econômico e social do Brasil.
A expansão do Brasil permitiu a Empresa alargar seus objetivos, adquirindo experiência e perícia em projetos de engenharia multidisciplinares de grande envergadura e complexidade nas áreas de metrôs, ferrovias, rodovias, aeroportos, portos, pontes, viadutos, recursos hídricos, saneamento, energia, obras enterradas, industriais, telecomunicações, edificações, meio ambiente, desenvolvimento urbano e regional, automação e controle de processos.
Como empresa de consultoria independente, desenvolve atividades de:
estudos técnicos e planejamento;
projetos conceituais, básicos e executivos;
assistência técnica, supervisão e fiscalização de obras;
gerenciamento de projetos, obras e programas;
planejamento e desenvolvimento de empreendimentos;
Ao longo de sua história de sucesso e realizações, vem formando técnicos de alto nível e profissionais engajados no oferecimento das melhores soluções para as necessidades dos clientes, preservando a filosofia de trabalho implantada pelo fundador e que tem pautado sua existência.
- Figueirense Futebol Clubefigueirense.com.br
O Figueirense Futebol Clube é um clube brasileiro de futebol sediado em Florianópolis, que disputa a Série A do Campeonato Brasileiro na temporada de 2012. Também é conhecido como o 'Furacão do Estreito' (Bairro onde o Estádio Orlando Scarpelli está localizado), ou simplesmente 'Figueira'. O Figueirense é um dos clubes mais vezes campeão do Campeonato Catarinense, com 15 títulos conquistados.
É o clube mais velho de Santa Catarina que mais participou do Campeonato Brasileiro, com treze participações.
Conhecido pela fidelidade de sua torcida, é o clube de Santa Catarina com a maior média de público já registrada em uma única competição nacional, e também o clube catarinense com a maior média histórica de público no Campeonato Brasileiro da Série A.
- Figurad Bedrijfsrevisorenfigurad.be
Figurad is een onafhankelijk auditkantoor
U maakt kennis met een ervaren team van bedrijfsrevisoren en auditors die een glasheldere en kwalitatieve audit uitvoeren conform de Internationale Audit Standaarden. En dat voor alle stakeholders van uw onderneming.
Uw audit is gebouwd op 25 jaar ervaring
Een gezonde mix van jong talent en ervaren auditors uit gevestigde kantoren staan klaar om u te helpen. En dat rond alle aspecten in verband met controle en verslaggeving in diverse sectoren, profit of non-profit.
Persoonlijk en flexibel
We maken er een punt van dat u als klant ook de vennoten ontmoet. Zo zijn we nauw betrokken en investeren we in een stabiele en duurzame langetermijnrelatie. Dankzij een direct en open contact met onze medewerkers helpen we u snel vooruit.
Kwalitatieve dienstverlening voor een correcte prijs
Onze medewerkers worden elk kwartaal professioneel geïnformeerd over de laatste wettelijke wijzigingen. Op die manier bieden we u een kwalitatieve audit aan. En dat tegen een correcte prijs.
Lid van BKR
Figurad maakt deel uit van een Internationale Associatie van onafhankelijke Accountants en Auditors. BKR International is een van de top tien globale accounting en auditassociaties die meer dan 160 onafhankelijke accounting en auditfirma's in 500 kantoren en 80 landen vertegenwoordigt.
Hierdoor kunnen we ook voor buitenlandse filialen van Belgische ondernemingen een onafhankelijke audit uit laten voeren. En dat in nauwe samenwerking met internationale BKR-erkende auditkantoren.
RJC geaccrediteerd
Sedert 2010 is FIGURAD een RJC geaccrediteerd auditkantoor. RJC staat voor de "Responsible Jewellery Council" welke instaat voor het ontwikkelen van standaarden en het verlenen van certificaten in de diamantsector. Elk RJC-lid moet binnen de 2 jaar na toetreding een compliance audit met de RJC Code of Practices laten uitvoeren. Het certificaat is nadien drie jaar geldig. Figurad kan deze compliance audit voor u uitvoeren.
- Figure 1figure1.com
Figure 1 connects healthcare professionals around the world to view, discuss, and share medical cases. It is used by a global community of millions of healthcare professionals.
Figure 1 has received considerable media coverage in outlets such as The Wall Street Journal, BBC, ABC, CBS, and CNN. Our fast-growing company, with offices in Toronto and New York, was listed as one of the top startups to watch in 2016 by Betakit.
- Figure8 New Zealandfigure8.co.nz
OUR PEOPLE:
Figure8 is run by IT professionals. We are passionate about what and how we deliver. Our business is our reputation. We employ people who we trust. We distinguish ourselves through success.
OUR BACKGROUND:
Figure8 was created to fill a niche in the New Zealand IT marketplace.
Consolidation within the industry has resulted in the polarisation of service providers. Providers are either large and focused on enterprise clients, or small and focused on the small and medium sized market. In contrast, Figure8 is a small independent consultancy that focuses solely on the enterprise market.
OUR OBJECTIVES:
Figure8 understands IT infrastructure, and will;
• Add transparency to vendor relationship
• Re-negotiate contracts for cost-reduction
• Provide technical excellence to shake-up existing teams and vendors
• Provide independent architecture and project management to bring together the components of successful project delivery
• Bring our passion for IT into your infrastructure
- mobiles Puppen und Figurentheater Kölnfigurentheater-koeln.de
mobiles Puppen und Figurentheater Köln is a company based out of Germany.
- Figures of Speech Theatrefigures.org
Figures of Speech was founded by Carol Llewellyn and John Farrell in 1982, bringing together their passions for dance, theater, sculpture and poetry. From that mix they forged a vision of performance that focused on the metaphoric expressiveness of the puppet and the power of visual imagery.
The company has toured all over the world - from Sofia, Bulgaria to Tokyo, Japan, to Lima, Peru - at venues including the Kennedy Center, the Smithsonian Institution, and the New Victory Theatre on Broadway.
While we're known for our groundbreaking work juxtaposing puppets, actors and other stage media, we're also interested in the performance of literary text: our latest work is a solo recitation from memory of T.S. Eliot's poetic masterpiece, Four Quartets.
FST's unique approach to theater has led to collaborations with other arts organizations such as the DaPonte String Quartet (Words Move/Music Moves), Portland Stage Company (Peer Gynt), Heartwood Regional Theater (Gilgamesh), the Portland Symphony Orchestra (Magic of Christmas) and the Freeport Shakespeare Festival (The Tempest).
The artists at FST conjure and create puppets, masks and costumes for venues ranging from expansive concert halls to exuberant outdoor festivals. The creative team draws upon carving techniques gleaned from a fellowship with a Japanese puppet carving master, graduate school training in costume and theater design, and 30 years of experience sculpting, drafting, casting, painting and imagining.
- Foundation Insurance Groupfigva.com
At Foundation Insurance Group, our rock-solid promise to you is that we will
provide the coverage you need with the personalized service you expect.
Committed to integrity since our founding in 1994, we've built our
reputation on meeting the needs of our customers. We remain steadfastly
dedicated to providing you with quality, customized insurance solutions.
Our knowledgeable team of seasoned professionals takes the time to build
relationships with our clients. We listen to our customers' insurance needs,
and search a wide range of insurance companies to find the coverage that's
tailor-made for you.
Contact us now for any of your Insurance needs! We are always happy to help!
- Fih Mobile Ltdfih-foxconn.com
Fih Mobile is a telecommunications company based out of LANGFANG. Fih Mobile representatives, don't miss out on opportunities to build relationships with members on LinkedIn. Claim your page, write a simple description, and share content to attract followers that can lead to new customers, brand fans, and future employees. Go here to get started: http://linkd.in/1DUpBvu
- International Hockey Federation (FIH)fih.ch
The International Hockey Federation (FIH) is the world governing body for the sport of hockey, recognised by the International Olympic Committee (IOC). Founded in 1924, FIH today has 137 member National Associations.
Facebook : https://www.facebook.com/fihockey
Twitter : https://twitter.com/FIH_Hockey
Youtube channel : http://www.youtube.com/fihockey
Instagram : http://instagram.com/fihockey
- Fihocafihoca.com
Fihoca es una empresa especializada en consultoría y desarrollo de sistemas de información, prestación de servicios y software factory.
Con 25 años de historia, Fihoca dispone de capital íntegramente nacional y cuenta con más de 140 profesionales altamente cualificados que realizan servicios en todo el territorio español.
Con una dilatada experiencia en el core de los sistemas de información de medianas y grandes corporaciones, ofrecemos apoyo en el ámbito de estrategia TI y ejecución operativa. Y en cualquiera de sus modalidades:
- Proyectos 'llaves en mano'
- Integración en el equipo de nuestros clientes
- Gestión de mantenimiento de aplicaciones con fórmulas como outsourcing, cosourcing, factoría de software, etc.
Además, somos IBM Silver Business Partner destacado en soluciones de Social Business, Commerce, Information Management, Cloud & Mobility y Smart Business.
- Federazione Italiana Hockey e Pattinaggiofihp.org
- FIHRST Management Servicesfihrst.com
FIHRST is the largest payroll payments service provider in South Africa and a subsidiary of Net1 UEPS Inc. FIHRST has its head office in Johannesburg but has regional offices in Cape Town, Durban and Port Eilzabeth with a customer base that covers South Africa
- Fundación Instituto de Ingenieríafii.gob.ve
La FIIIDT, es un ente adscrito al Ministerio del Poder Popular para Educacion Universitaria, Ciencia, Tecnología, del Gobierno Bolivariano de Venezuela.
- FIIG Securitiesfiig.com.au
FIIG is committed to providing direct access to bond markets for more investors.
We provide investors with choice and control, delivered through services that enable direct ownership of bonds and easy management of cash deposits.
Through industry leading research and education initiatives, FIIG empowers investors and their advisors with knowledge and insights – and with offices in Sydney, Melbourne, Brisbane and Perth, FIIG's 130 strong team provide expert service and support to clients across Australia.
The result; No matter what type of investor you are, control remains where it should be – with you.
- Forsvarsministeriets Regnskabsstyrelsefiin.dk
Forsvarsministeriets Regnskabsstyrelse (FRS) er beliggende i Hjørring. Styrelsens ca. 170 medarbejdere varetager regnskabsopgaver for Forsvarsministeriet og underliggende myndigheder.
Som koncernens administrative shared service center har styrelsen en bred opgaveportefølje, som spænder fra rejseafregning og fakturabehandling til styring af likviditet over udvikling af regnskabsmodel- og regnskabssystemer, finansiel controlling samt udarbejdelse af koncernens samlede bevillingsregnskab og samlede omkostningsbaserede regnskab.
FRS arbejder kontinuerligt med procesoptimering ud fra kendte lean-principper.
Styrelsen støtter internationale operationer (INTOPS) ved udsendelse af regnskabsmedarbejdere til danske lejre i udlandet for primært at varetage pengeforsyning og kassefunktion. FRS står selv for regnskabsuddannelsen af de udsendte medarbejdere og myndighedernes kasseansvarlige/ regnskabsfører.